The store will not work correctly when cookies are disabled.
Your company account is blocked and you cannot place orders. If you have questions, please contact your company administrator.
CD3D
| Description | T-cell surface glycoprotein CD3 delta chain |
|---|
Gene and Protein Information
| Gene ID | 915 |
|---|
| Uniprot Accession IDs | P04234 A8MVP6 |
|---|
| Ensembl ID | ENSP00000300692 |
|---|
| Symbol | T3D T3D IMD19 CD3-DELTA |
|---|
| Sequence | MEHSTFLSGLVLATLLSQVSPFKIPIEELEDRVFVNCNTSITWVEGTVGTLLSDITRLDLGKRILDPRGIYRCNGTDIYKDKESTVQVHYRMCQSCVELDPATVAGIIVTDVIATLLLALGVFCFAGHETGRLSGAADTQALLRNDQVYQPLRDRDDAQYSHLGGNWARNK |
|---|
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|
| Chimp | 451584 | CD3D | CD3d molecule | 9598 | VGNC:6481 | OMA, EggNOG |
| Macaque | 699582 | CD3D | CD3d molecule | 9544 | | Inparanoid, EggNOG |
| Mouse | 12500 | Cd3d | CD3 antigen, delta polypeptide | 10090 | MGI:88331 | Inparanoid, OMA, EggNOG |
| Rat | 25710 | Cd3d | CD3d molecule | 10116 | RGD:2304 | Inparanoid, OMA, EggNOG |
| Dog | 479419 | CD3D | CD3d molecule | 9615 | VGNC:38954 | Inparanoid, OMA, EggNOG |
| Horse | 100062931 | CD3D | CD3d molecule | 9796 | VGNC:16263 | Inparanoid, OMA, EggNOG |
| Cow | 281053 | CD3D | CD3d molecule | 9913 | VGNC:27028 | Inparanoid, OMA, EggNOG |
| Pig | 396661 | CD3D | CD3d molecule | 9823 | | Inparanoid, OMA, EggNOG |
| Opossum | 100031472 | CD3D | CD3d molecule | 13616 | | Inparanoid, OMA, EggNOG |
| Chicken | 396518 | CD3D | CD3d molecule | 9031 | CGNC:49849 | OMA, EggNOG |
| Xenopus | 100216101 | cd3g | CD3g molecule | 8364 | XB-GENE-480422 | OMA, EggNOG |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Availability | View Details |
|---|
The page will load shortly, Thanks for your patience!
Associated Antibodies
| Name | Specifications | Species reactivity | Application | Availability | View Details |
|---|
The page will load shortly, Thanks for your patience!
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
The page will load shortly, Thanks for your patience!
