JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

Click Here for 5% Off Your First Aladdin Purchase!

྾

Protein or Target Summary

T-cell surface glycoprotein CD3 delta chain

Gene ID	915
uniprot	P04234
Gene Name	CD3D
Ensernbl ID	ENSP00000300692
Sequence	MEHSTFLSGLVLATLLSQVSPFKIPIEELEDRVFVNCNTSITWVEGTVGTLLSDITRLDLGKRILDPRGIYRCNGTDIYKDKESTVQVHYRMCQSCVELDPATVAGIIVTDVIATLLLALGVFCFAGHETGRLSGAADTQALLRNDQVYQPLRDRDDAQYSHLGGNWARNK Show more

Gene and Protein Information

Species	Gene ID	Gene Symbol	Gene Name	Uniprot
HUMAN	915	CD3D	T-cell surface glycoprotein CD3 delta chain	P04234
MOUSE	12500	Cd3d	T-cell surface glycoprotein CD3 delta chain	P04235
MOUSE	12500	Cd3d	CD3 antigen, delta polypeptide	Q6P5P1
MOUSE		Cd3d	T3 delta-chain	A0N8K9
MOUSE		Cd3d	Uncharacterized protein	Q3U572
MOUSE		Cd3d	CD3 antigen delta polypeptide	B0L6U8
MOUSE	12500	Cd3d	Uncharacterized protein	Q3V3B4
MOUSE		Cd3d	T-cell surface glycoprotein CD3 delta chain	A0A1L1SV10
MOUSE	12500	Cd3d	CD3 antigen delta polypeptide	Q3U4T1
RAT	25710	Cd3d	T-cell surface glycoprotein CD3 delta chain	P19377

Associated Recombinant Proteins

Name	Specification and purity	Expression system	Protein label	Activity	View Details

Associated Antibodies

Name	Specifications	Species reactivity	species	Application	View Details

Associated Approved Drugs

Associated Active Ligands

Associated Diseases

Name	Disease Type	Mondoid

Pathway

Data Source	Name	Explore more targets	Explore in Source

Source: DataSourcesLicenses.xlsx