The store will not work correctly when cookies are disabled.
Your company account is blocked and you cannot place orders. If you have questions, please contact your company administrator.
CD3E
Description | T-cell surface glycoprotein CD3 epsilon chain |
---|
Gene and Protein Information
Gene ID | 916 |
Uniprot Accession IDs | P07766 A8K997 |
Ensembl ID | ENSP00000354566 |
Symbol | T3E T3E TCRE IMD18 |
Sequence | MQSGTHWRVLGLCLLSVGVWGQDGNEEMGGITQTPYKVSISGTTVILTCPQYPGSEILWQHNDKNIGGDEDDKNIGSDEDHLSLKEFSELEQSGYYVCYPRGSKPEDANFYLYLRARVCENCMEMDVMSVATIVIVDICITGGLLLLVYYWSKNRKAKAKPVTRGAGAGGRQRGQNKERPPPVPNPDYEPIRKGQRDLYSGLNQRRI |
---|
Homologous gene and protein info.
Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
Chimp | 742330 | CD3E | CD3e molecule | 9598 | VGNC:6482 | OMA, EggNOG |
Macaque | 699467 | CD3E | CD3e molecule | 9544 | | Inparanoid, OMA, EggNOG |
Mouse | 12501 | Cd3e | CD3 antigen, epsilon polypeptide | 10090 | MGI:88332 | Inparanoid, OMA, EggNOG |
Rat | 315609 | Cd3e | CD3e molecule | 10116 | RGD:1309222 | Inparanoid, OMA, EggNOG |
Dog | 442981 | CD3E | CD3e molecule | 9615 | VGNC:38955 | Inparanoid, OMA, EggNOG |
Horse | 100629532 | CD3E | CD3e molecule | 9796 | VGNC:16264 | Inparanoid, OMA, EggNOG |
Cow | 281054 | CD3E | CD3e molecule | 9913 | VGNC:27029 | Inparanoid, OMA, EggNOG |
Pig | 397455 | CD3E | CD3e molecule | 9823 | | Inparanoid, EggNOG |
Opossum | 100031478 | CD3E | CD3e molecule | 13616 | | Inparanoid, OMA, EggNOG |
Chicken | 396062 | CD3E | CD3e molecule | 9031 | CGNC:5597 | Inparanoid, OMA, EggNOG |
Xenopus | 100101735 | cd3e | CD3e molecule | 8364 | XB-GENE-919749 | Inparanoid, OMA, EggNOG |
Associated Recombinant Proteins
Name | Specification and purity | Expression system | Protein label | Availability | View Details |
---|
Associated Antibodies
Name | Specifications | Species reactivity | Application | Availability | View Details |
---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
Name | Direct Associated Targets | Disease Type | Mondoid |
---|
The page will load shortly, Thanks for your patience!
Bibliography
The page will load shortly, Thanks for your patience!