The store will not work correctly when cookies are disabled.
CD3E
| Description | T-cell surface glycoprotein CD3 epsilon chain |
|---|
Gene and Protein Information
| Gene ID | 916 |
|---|
| Uniprot Accession IDs | A8K997 |
|---|
| Ensembl ID | ENSP00000354566 |
|---|
| Symbol | T3E T3E TCRE IMD18 |
|---|
| Sequence | MQSGTHWRVLGLCLLSVGVWGQDGNEEMGGITQTPYKVSISGTTVILTCPQYPGSEILWQHNDKNIGGDEDDKNIGSDEDHLSLKEFSELEQSGYYVCYPRGSKPEDANFYLYLRARVCENCMEMDVMSVATIVIVDICITGGLLLLVYYWSKNRKAKAKPVTRGAGAGGRQRGQNKERPPPVPNPDYEPIRKGQRDLYSGLNQRRI |
|---|
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|
| Chimp | 742330 | CD3E | CD3e molecule | 9598 | VGNC:6482 | OMA, EggNOG |
| Macaque | 699467 | CD3E | CD3e molecule | 9544 | | Inparanoid, OMA, EggNOG |
| Mouse | 12501 | Cd3e | CD3 antigen, epsilon polypeptide | 10090 | MGI:88332 | Inparanoid, OMA, EggNOG |
| Rat | 315609 | Cd3e | CD3e molecule | 10116 | RGD:1309222 | Inparanoid, OMA, EggNOG |
| Dog | 442981 | CD3E | CD3e molecule | 9615 | VGNC:38955 | Inparanoid, OMA, EggNOG |
| Horse | 100629532 | CD3E | CD3e molecule | 9796 | VGNC:16264 | Inparanoid, OMA, EggNOG |
| Cow | 281054 | CD3E | CD3e molecule | 9913 | VGNC:27029 | Inparanoid, OMA, EggNOG |
| Pig | 397455 | CD3E | CD3e molecule | 9823 | | Inparanoid, EggNOG |
| Opossum | 100031478 | CD3E | CD3e molecule | 13616 | | Inparanoid, OMA, EggNOG |
| Chicken | 396062 | CD3E | CD3e molecule | 9031 | CGNC:5597 | Inparanoid, OMA, EggNOG |
| Xenopus | 100101735 | cd3e | CD3e molecule | 8364 | XB-GENE-919749 | Inparanoid, OMA, EggNOG |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
