The store will not work correctly when cookies are disabled.
Protein or Target Summary
T-cell surface glycoprotein CD3 epsilon chain
| Gene ID | 916 |
|---|
| uniprot | P07766 |
|---|
| Gene Name | CD3E |
|---|
| Ensernbl ID | ENSP00000354566 |
|---|
| Sequence | MQSGTHWRVLGLCLLSVGVWGQDGNEEMGGITQTPYKVSISGTTVILTCPQYPGSEILWQHNDKNIGGDEDDKNIGSDEDHLSLKEFSELEQSGYYVCYPRGSKPEDANFYLYLRARVCENCMEMDVMSVATIVIVDICITGGLLLLVYYWSKNRKAKAKPVTRGAGAGGRQRGQNKERPPPVPNPDYEPIRKGQRDLYSGLNQRRI Show more |
|---|
Gene and Protein Information
| Species | Gene ID | Gene Symbol | Gene Name | Uniprot |
|---|
| HUMAN | 916 | CD3E | T-cell surface glycoprotein CD3 epsilon chain | P07766 |
| MOUSE | 12501 | Cd3e | T-cell surface glycoprotein CD3 epsilon chain | P22646 |
| MOUSE | | Cd3e | CD3 antigen epsilon polypeptide | B0LAX5 |
| MOUSE | 12501 | Cd3e | CD3 antigen epsilon polypeptide | A6H6M1 |
| RAT | | Cd3e | CD3e molecule | A0A0G2K986 |
| RAT | 315609 | Cd3e | CD3 antigen, epsilon polypeptide (Predicted) | D4A5M2 |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
