Protein or Target Summary
Cyclin-dependent kinase 20
| Gene ID | 23552 |
|---|---|
| uniprot | Q8IZL9 |
| Gene Name | CDK20 |
| Ensernbl ID | ENSP00000322343 |
| Family | Belongs to the protein kinase superfamily. CMGC Ser/Thr protein kinase family. CDC2/CDKX subfamily. |
| Sequence | MDQYCILGRIGEGAHGIVFKAKHVETGEIVALKKVALRRLEDGFPNQALREIKALQEMEDNQYVVQLKAVFPHGGGFVLAFEFMLSDLAEVVRHAQRPLAQAQVKSYLQMLLKGVAFCHANNIVHRDLKPANLLISASGQLKIADFGLARVFSPDGSRLYTHQVATRWYRAPELLYGARQYDQGVDLWSVGCIMGELLNGSPLFPGKNDIEQLCYVLRILGTPNPQVWPELTELPDYNKISFKEQVPMPLEEVLPDVSPQALDLLGQFLLYPPHQRIAASKALLHQYFFTAPLPAHPSELPIPQRLGGPAPKAHPGPPHIHDFHVDRPLEESLLNPELIRPFILEG Show more |
Gene and Protein Information
| Species | Gene ID | Gene Symbol | Gene Name | Uniprot |
|---|---|---|---|---|
| HUMAN | 23552 | CDK20 | Cyclin-dependent kinase 20 | Q8IZL9 |
| MOUSE | Cdk20 | Cyclin-dependent kinase 20 | A0A1Y7VIW8 | |
| MOUSE | Cdk20 | Cyclin-dependent kinase 20 | A0A1Y7VJE1 | |
| MOUSE | Cdk20 | Cyclin-dependent kinase 20 | A0A1Y7VJN2 | |
| MOUSE | Cdk20 | Cyclin-dependent kinase 20 | A0A1Y7VKB8 | |
| MOUSE | Cdk20 | Cyclin-dependent kinase 20 | A0A1Y7VNS6 | |
| MOUSE | 105278 | Cdk20 | Cyclin-dependent kinase 20 | Q9JHU3 |
| RAT | 364666 | Cdk20 | Cyclin-dependent kinase 20 | Q4KM34 |
Protein Classes
PANTHER Classes
protein / non-receptor serine/threonine protein kinase / Cyclin-dependent kinase 20
protein / protein kinase / Cyclin-dependent kinase 20
protein / non-receptor tyrosine protein kinase / Cyclin-dependent kinase 20
protein / transferase / Cyclin-dependent kinase 20
protein / kinase / Cyclin-dependent kinase 20
protein / non-receptor serine/threonine protein kinase / Cyclin-dependent kinase 20
protein / protein kinase / Cyclin-dependent kinase 20
protein / non-receptor tyrosine protein kinase / Cyclin-dependent kinase 20
protein / transferase / Cyclin-dependent kinase 20
protein / kinase / Cyclin-dependent kinase 20
DTO Classes
protein / Kinase / Protein kinase / CMGC group / CDK family / CCRK subfamily / Cyclin-dependent kinase 20
protein / Kinase / Protein kinase / CMGC group / CDK family / CCRK subfamily / Cyclin-dependent kinase 20
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Disease Type | Mondoid |
|---|
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
Source: DataSourcesLicenses.xlsx