The store will not work correctly when cookies are disabled.
CDKN1B
Description | Cyclin-dependent kinase inhibitor 1B |
---|
Gene and Protein Information
Gene ID | 1027 |
Uniprot Accession IDs | Q16307 Q5U0H2 Q9BUS6 |
Ensembl ID | ENSP00000228872 |
Symbol | KIP1 KIP1 MEN4 CDKN4 MEN1B P27KIP1 |
Family | Belongs to the CDI family. |
Sequence | MSNVRVSNGSPSLERMDARQAEHPKPSACRNLFGPVDHEELTRDLEKHCRDMEEASQRKWNFDFQNHKPLEGKYEWQEVEKGSLPEFYYRPPRPPKGACKVPAQESQDVSGSRPAAPLIGAPANSEDTHLVDPKTDPSDSQTGLAEQCAGIRKRPATDDSSTQNKRANRTEENVSDGSPNAGSVEQTPKKPGLRRRQT |
---|
Homologous gene and protein info.
Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
Chimp | 466947 | CDKN1B | cyclin dependent kinase inhibitor 1B | 9598 | VGNC:8367 | OMA, EggNOG |
Macaque | 697188 | CDKN1B | cyclin dependent kinase inhibitor 1B | 9544 | | Inparanoid, EggNOG |
Mouse | 12576 | Cdkn1b | cyclin-dependent kinase inhibitor 1B | 10090 | MGI:104565 | Inparanoid, OMA, EggNOG |
Rat | 83571 | Cdkn1b | cyclin-dependent kinase inhibitor 1B | 10116 | RGD:69062 | Inparanoid, OMA, EggNOG |
Dog | 403429 | CDKN1B | cyclin dependent kinase inhibitor 1B | 9615 | VGNC:39069 | Inparanoid, OMA, EggNOG |
Cow | 512613 | CDKN1B | cyclin dependent kinase inhibitor 1B | 9913 | VGNC:27143 | Inparanoid, OMA, EggNOG |
Opossum | 100014923 | CDKN1B | cyclin dependent kinase inhibitor 1B | 13616 | | Inparanoid, OMA, EggNOG |
Anole lizard | 100565071 | cdkn1b | cyclin dependent kinase inhibitor 1B | 28377 | | Inparanoid, OMA |
C. elegans | 174261 | cki-2 | CKI family (Cyclin-dependent Kinase Inhibitor) | 6239 | | Inparanoid, OMA |
Associated Recombinant Proteins
Name | Specification and purity | Expression system | Protein label | Activity | View Details |
---|
Associated Antibodies
Name | Specifications | Species reactivity | species | Application | View Details |
---|
Associated Approved Drugs
Associated Active Ligands
Pathway
Data Source | Name | Explore more targets | Explore in Source |
---|