The store will not work correctly when cookies are disabled.
CD59
Description | CD59 glycoprotein |
---|
Gene and Protein Information
Gene ID | 966 |
Uniprot Accession IDs | P13987 |
Ensembl ID | ENSP00000379191 |
Symbol | MIC11 MIN1 MIN2 MIN3 MSK21 1F5 EJ16 EJ30 EL32 G344 MIN1 MIN2 MIN3 MIRL HRF20 MACIF MEM43 MIC11 MSK21 16.3A5 HRF-20 MAC-IP p18-20 |
Sequence | MGIQGGSVLFGLLLVLAVFCHSGHSLQCYNCPNPTADCKTAVNCSSDFDACLITKAGLQVYNKCWKFEHCNFNDVTTRLRENELTYYCCKKDLCNFNEQLENGGTSLSEKTVLLLVTPFLAAAWSLHP |
---|
Homologous gene and protein info.
Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
Chimp | 739046 | CD59 | CD59 molecule (CD59 blood group) | 9598 | VGNC:11287 | OMA, EggNOG |
Mouse | 333883 | Cd59b | CD59b antigen | 10090 | MGI:1888996 | OMA, EggNOG |
Mouse | 12509 | Cd59a | CD59a antigen | 10090 | MGI:109177 | Inparanoid, OMA |
Rat | 25407 | Cd59 | CD59 molecule | 10116 | RGD:2311 | Inparanoid, OMA, EggNOG |
Dog | 475945 | CD59 | CD59 molecule (CD59 blood group) | 9615 | | Inparanoid, OMA, EggNOG |
Cow | 505574 | CD59 | CD59 molecule (CD59 blood group) | 9913 | | Inparanoid, OMA, EggNOG |
Pig | 397347 | CD59 | CD59 molecule (CD59 blood group) | 9823 | | Inparanoid, OMA, EggNOG |
Associated Recombinant Proteins
Name | Specification and purity | Expression system | Protein label | Activity | View Details |
---|
Associated Antibodies
Name | Specifications | Species reactivity | species | Application | View Details |
---|
Associated Approved Drugs
Associated Active Ligands
Pathway
Data Source | Name | Explore more targets | Explore in Source |
---|