| Description | CCAAT/enhancer-binding protein alpha |
|---|
Gene and Protein Information
| Gene ID | 1050 |
|---|---|
| Uniprot Accession IDs | A7LNP2 P78319 Q05CA4 C/EBP alpha |
| Ensembl ID | ENSP00000427514 |
| Symbol | CEBP CEBP C/EBP-alpha |
| Family | Belongs to the bZIP family. C/EBP subfamily. |
| Sequence | MESADFYEAEPRPPMSSHLQSPPHAPSSAAFGFPRGAGPAQPPAPPAAPEPLGGICEHETSIDISAYIDPAAFNDEFLADLFQHSRQQEKAKAAVGPTGGGGGGDFDYPGAPAGPGGAVMPGGAHGPPPGYGCAAAGYLDGRLEPLYERVGAPALRPLVIKQEPREEDEAKQLALAGLFPYQPPPPPPPSHPHPHPPPAHLAAPHLQFQIAHCGQTTMHLQPGHPTPPPTPVPSPHPAPALGAAGLPGPGSALKGLGAAHPDLRASGGSGAGKAKKSVDKNSNEYRVRRERNNIAVRKSRDKAKQRNVETQQKVLELTSDNDRLRKRVEQLSRELDTLRGIFRQLPESSLVKAMGNCA Show more |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Mouse | 12606 | Cebpa | CCAAT/enhancer binding protein (C/EBP), alpha | 10090 | MGI:99480 | Inparanoid, OMA, EggNOG |
| Rat | 24252 | Cebpa | CCAAT/enhancer binding protein alpha | 10116 | RGD:2326 | Inparanoid, OMA, EggNOG |
| Pig | 397307 | CEBPA | CCAAT/enhancer binding protein alpha | 9823 | Inparanoid, OMA, EggNOG | |
| Platypus | CEBPA | CCAAT/enhancer binding protein alpha [Source:HGNC Symbol;Acc:HGNC:1833] | 9258 | OMA, EggNOG | ||
| Xenopus | 496454 | cebpa | CCAAT enhancer binding protein alpha | 8364 | XB-GENE-853397 | Inparanoid, OMA |
| Zebrafish | 140815 | cebpa | CCAAT enhancer binding protein alpha | 7955 | ZDB-GENE-020111-2 | Inparanoid, OMA |
Protein Classes
PANTHER Classes
protein / transcription factor / basic leucine zipper transcription factor / CCAAT/enhancer-binding protein alpha
protein / transcription factor / nucleic acid binding / CCAAT/enhancer-binding protein alpha
protein / transcription factor / basic leucine zipper transcription factor / CCAAT/enhancer-binding protein alpha
protein / transcription factor / nucleic acid binding / CCAAT/enhancer-binding protein alpha
DTO Classes
protein / Transcription factor / Basic leucine zipper transcription factor / CCAAT/enhancer-binding protein alpha
protein / Transcription factor / Basic leucine zipper transcription factor / CCAAT/enhancer-binding protein alpha
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Disease Type | Mondoid |
|---|
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|