CDK5
| Description | Cyclin-dependent-like kinase 5 |
|---|
Gene and Protein Information
| Gene ID | 1020 |
|---|---|
| Uniprot Accession IDs | A1XKG3 |
| Ensembl ID | ENSP00000419782 |
| Symbol | CDKN5 LIS7 PSSALRE |
| Family | Belongs to the protein kinase superfamily. CMGC Ser/Thr protein kinase family. CDC2/CDKX subfamily. |
| Sequence | MQKYEKLEKIGEGTYGTVFKAKNRETHEIVALKRVRLDDDDEGVPSSALREICLLKELKHKNIVRLHDVLHSDKKLTLVFEFCDQDLKKYFDSCNGDLDPEIVKSFLFQLLKGLGFCHSRNVLHRDLKPQNLLINRNGELKLADFGLARAFGIPVRCYSAEVVTLWYRPPDVLFGAKLYSTSIDMWSAGCIFAELANAGRPLFPGNDVDDQLKRIFRLLGTPTEEQWPSMTKLPDYKPYPMYPATTSLVNVVPKLNATGRDLLQNLLKCNPVQRISAEEALQHPYFSDFCPP |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 463891 | CDK5 | cyclin dependent kinase 5 | 9598 | VGNC:7364 | OMA, EggNOG |
| Macaque | 714445 | CDK5 | cyclin dependent kinase 5 | 9544 | Inparanoid, OMA, EggNOG | |
| Mouse | 12568 | Cdk5 | cyclin-dependent kinase 5 | 10090 | MGI:101765 | Inparanoid, OMA, EggNOG |
| Rat | 140908 | Cdk5 | cyclin-dependent kinase 5 | 10116 | RGD:70514 | Inparanoid, OMA |
| Dog | 475537 | CDK5 | cyclin dependent kinase 5 | 9615 | VGNC:51795 | Inparanoid, OMA, EggNOG |
| Horse | 100063442 | CDK5 | cyclin dependent kinase 5 | 9796 | VGNC:16349 | Inparanoid, OMA, EggNOG |
| Cow | 281066 | CDK5 | cyclin dependent kinase 5 | 9913 | VGNC:27127 | Inparanoid, OMA, EggNOG |
| Pig | 733700 | CDK5 | cyclin dependent kinase 5 | 9823 | Inparanoid, OMA, EggNOG | |
| Opossum | 100015241 | CDK5 | cyclin dependent kinase 5 | 13616 | Inparanoid, OMA, EggNOG | |
| Xenopus | 780236 | cdk5 | cyclin-dependent kinase 5 | 8364 | XB-GENE-1010261 | Inparanoid, OMA, EggNOG |
| Zebrafish | 65234 | cdk5 | cyclin-dependent kinase 5 | 7955 | ZDB-GENE-010131-2 | Inparanoid, OMA, EggNOG |
| C. elegans | 176774 | cdk-5 | Cyclin-dependent-like kinase 5 | 6239 | Inparanoid, OMA | |
| Fruitfly | 36727 | Cdk5 | Cyclin-dependent kinase 5 | 7227 | FBgn0013762 | Inparanoid, OMA |
Protein Classes
PANTHER Classes
protein / non-receptor serine/threonine protein kinase / Cyclin-dependent-like kinase 5
protein / protein kinase / Cyclin-dependent-like kinase 5
protein / non-receptor tyrosine protein kinase / Cyclin-dependent-like kinase 5
protein / transferase / Cyclin-dependent-like kinase 5
protein / kinase / Cyclin-dependent-like kinase 5
protein / non-receptor serine/threonine protein kinase / Cyclin-dependent-like kinase 5
protein / protein kinase / Cyclin-dependent-like kinase 5
protein / non-receptor tyrosine protein kinase / Cyclin-dependent-like kinase 5
protein / transferase / Cyclin-dependent-like kinase 5
protein / kinase / Cyclin-dependent-like kinase 5
DTO Classes
protein / Kinase / Protein kinase / CMGC group / CDK family / CDK5 subfamily / Cyclin-dependent-like kinase 5
protein / Kinase / Protein kinase / CMGC group / CDK family / CDK5 subfamily / Cyclin-dependent-like kinase 5
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Disease Type | Mondoid |
|---|
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|