JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

྾

CYP46A1

Description	Cholesterol 24-hydroxylase

Gene and Protein Information

Gene ID	10858
Uniprot Accession IDs	B4DHP8 E7EQG9 Q8N2B0 CH24H
Ensembl ID	ENSP00000261835
Symbol	CYP46 CP46 CYP46
Family	Belongs to the cytochrome P450 family.
Sequence	MSPGLLLLGSAVLLAFGLCCTFVHRARSRYEHIPGPPRPSFLLGHLPCFWKKDEVGGRVLQDVFLDWAKKYGPVVRVNVFHKTSVIVTSPESVKKFLMSTKYNKDSKMYRALQTVFGERLFGQGLVSECNYERWHKQRRVIDLAFSRSSLVSLMETFNEKAEQLVEILEAKADGQTPVSMQDMLTYTAMDILAKAAFGMETSMLLGAQKPLSQAVKLMLEGITASRNTLAKFLPGKRKQLREVRESIRFLRQVGRDWVQRRREALKRGEEVPADILTQILKAEEGAQDDEGLLDNFVTFFIAGHETSANHLAFTVMELSRQPEIVARLQAEVDEVIGSKRYLDFEDLGRLQYLSQVLKESLRLYPPAWGTFRLLEEETLIDGVRVPGNTPLLFSTYVMGRMDTYFEDPLTFNPDRFGPGAPKPRFTYFPFSLGHRSCIGQQFAQMEVKVVMAKLLQRLEFRLVPGQRFGLQEQATLKPLDPVLCTLRPRGWQPAPPPPPC Show more

Homologous gene and protein info.

Species	Gene ID	Gene Symbol	Name	Tax ID	Other Gene ID	Sources
Chimp	453154	CYP46A1	cytochrome P450 family 46 subfamily A member 1	9598	VGNC:7521	OMA, EggNOG
Macaque	705843	LOC705843	cholesterol 24-hydroxylase	9544		OMA, EggNOG
Mouse	13116	Cyp46a1	cytochrome P450, family 46, subfamily a, polypeptide 1	10090	MGI:1341877	Inparanoid, OMA, EggNOG
Rat	362782	Cyp46a1	cytochrome P450, family 46, subfamily a, polypeptide 1	10116	RGD:1306605	Inparanoid, OMA
Dog	480432	CYP46A1	cytochrome P450 family 46 subfamily A member 1	9615	VGNC:50360	Inparanoid, OMA, EggNOG
Horse	100051131	LOC100051131	cholesterol 24-hydroxylase	9796		OMA, EggNOG
Cow		CYP46A1	cytochrome P450 family 46 subfamily A member 1 [Source:HGNC Symbol;Acc:HGNC:2641]	9913		OMA, EggNOG
Pig	100512793	LOC100512793	cholesterol 24-hydroxylase	9823		Inparanoid, OMA, EggNOG
Chicken	423450	CYP46A1	cytochrome P450 family 46 subfamily A member 1	9031	CGNC:8476	Inparanoid, OMA, EggNOG
Anole lizard	100552607	LOC100552607	cholesterol 24-hydroxylase	28377		OMA, EggNOG
Anole lizard	100552409	LOC100552409	cholesterol 24-hydroxylase	28377		Inparanoid, OMA
Xenopus	613109	mgc108213	uncharacterized protein mgc108213	8364	XB-GENE-969052	OMA, EggNOG

PANTHER Classes
protein / oxidoreductase / oxygenase / Cholesterol 24-hydroxylase

DTO Classes
protein / Enzyme / Oxidoreductase / Oxygenase / Cholesterol 24-hydroxylase

Name	Specification and purity	Expression system	Protein label	Activity	View Details

Name	Specifications	Species reactivity	species	Application	View Details

Name	Disease Type	Mondoid

Data Source	Name	Explore more targets	Explore in Source