The store will not work correctly when cookies are disabled.
COPS8
Description | COP9 signalosome complex subunit 8 |
---|
Gene and Protein Information
Gene ID | 10920 |
Uniprot Accession IDs | A8K1H6 Q53QS9 SGN8 |
Ensembl ID | ENSP00000346340 |
Symbol | CSN8 COP9 CSN8 SGN8 |
Family | Belongs to the CSN8 family. |
Sequence | MPVAVMAESAFSFKKLLDQCENQELEAPGGIATPPVYGQLLALYLLHNDMNNARYLWKRIPPAIKSANSELGGIWSVGQRIWQRDFPGIYTTINAHQWSETVQPIMEALRDATRRRAFALVSQAYTSIIADDFAAFVGLPVEEAVKGILEQGWQADSTTRMVLPRKPVAGALDVSFNKFIPLSEPAPVPPIPNEQQLARLTDYVAFLEN |
---|
Homologous gene and protein info.
Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
Macaque | 702097 | COPS8 | COP9 signalosome subunit 8 | 9544 | | OMA, EggNOG |
Mouse | 108679 | Cops8 | COP9 signalosome subunit 8 | 10090 | MGI:1915363 | Inparanoid, OMA, EggNOG |
Rat | 363283 | Cops8 | COP9 signalosome subunit 8 | 10116 | RGD:1311404 | Inparanoid, OMA, EggNOG |
Dog | 477417 | COPS8 | COP9 signalosome subunit 8 | 9615 | | Inparanoid, OMA, EggNOG |
Horse | 100057535 | COPS8 | COP9 signalosome subunit 8 | 9796 | VGNC:16778 | Inparanoid, OMA, EggNOG |
Cow | 540493 | COPS8 | COP9 signalosome subunit 8 | 9913 | VGNC:27606 | Inparanoid, OMA, EggNOG |
Pig | 100515865 | COPS8 | COP9 signalosome subunit 8 | 9823 | | OMA, EggNOG |
Opossum | 100010441 | COPS8 | COP9 signalosome subunit 8 | 13616 | | Inparanoid, OMA, EggNOG |
Anole lizard | 100561349 | cops8 | COP9 signalosome subunit 8 | 28377 | | Inparanoid, OMA, EggNOG |
Xenopus | 394711 | cops8 | COP9 signalosome subunit 8 | 8364 | XB-GENE-5956805 | OMA, EggNOG |
Zebrafish | 393198 | cops8 | COP9 signalosome subunit 8 | 7955 | ZDB-GENE-040426-982 | Inparanoid, OMA, EggNOG |
Fruitfly | 49077 | CSN8 | COP9 signalosome subunit 8 | 7227 | FBgn0261437 | Inparanoid, OMA, EggNOG |
Protein Classes
DTO Classes protein /
Signaling / COP9 signalosome complex subunit 8
Associated Recombinant Proteins
Name | Specification and purity | Expression system | Protein label | Availability | View Details |
---|
Associated Antibodies
Name | Specifications | Species reactivity | Application | Availability | View Details |
---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
Name | Direct Associated Targets | Disease Type | Mondoid |
---|
Pathway
Data Source | Name | Explore more targets | Explore in Source |
---|