COPS8

DescriptionCOP9 signalosome complex subunit 8

Gene and Protein Information

Gene ID10920
Uniprot Accession IDs A8K1H6 Q53QS9 SGN8
Ensembl ID ENSP00000346340
Symbol CSN8 COP9 CSN8 SGN8
FamilyBelongs to the CSN8 family.
Sequence
MPVAVMAESAFSFKKLLDQCENQELEAPGGIATPPVYGQLLALYLLHNDMNNARYLWKRIPPAIKSANSELGGIWSVGQRIWQRDFPGIYTTINAHQWSETVQPIMEALRDATRRRAFALVSQAYTSIIADDFAAFVGLPVEEAVKGILEQGWQADSTTRMVLPRKPVAGALDVSFNKFIPLSEPAPVPPIPNEQQLARLTDYVAFLEN
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameTax IDOther Gene IDSources
Macaque702097COPS8COP9 signalosome subunit 89544OMA, EggNOG
Mouse108679Cops8COP9 signalosome subunit 810090MGI:1915363Inparanoid, OMA, EggNOG
Rat363283Cops8COP9 signalosome subunit 810116RGD:1311404Inparanoid, OMA, EggNOG
Dog477417COPS8COP9 signalosome subunit 89615Inparanoid, OMA, EggNOG
Horse100057535COPS8COP9 signalosome subunit 89796VGNC:16778Inparanoid, OMA, EggNOG
Cow540493COPS8COP9 signalosome subunit 89913VGNC:27606Inparanoid, OMA, EggNOG
Pig100515865COPS8COP9 signalosome subunit 89823OMA, EggNOG
Opossum100010441COPS8COP9 signalosome subunit 813616Inparanoid, OMA, EggNOG
Anole lizard100561349cops8COP9 signalosome subunit 828377Inparanoid, OMA, EggNOG
Xenopus394711cops8COP9 signalosome subunit 88364XB-GENE-5956805OMA, EggNOG
Zebrafish393198cops8COP9 signalosome subunit 87955ZDB-GENE-040426-982Inparanoid, OMA, EggNOG
Fruitfly49077CSN8COP9 signalosome subunit 87227FBgn0261437Inparanoid, OMA, EggNOG

Protein Classes

PANTHER Classes
protein    /    signaling molecule    /    COP9 signalosome complex subunit 8
DTO Classes
protein    /    Signaling    /    COP9 signalosome complex subunit 8

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelAvailabilityView Details

Associated Antibodies

NameSpecificationsSpecies reactivityApplicationAvailabilityView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Pathway

      Data SourceNameExplore more targetsExplore in Source