JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

Click Here for 5% Off Your First Aladdin Purchase!

྾

Protein or Target Summary

COP9 signalosome complex subunit 8

Gene ID	10920
uniprot	Q99627
Gene Name	COPS8
Ensernbl ID	ENSP00000346340
Family	Belongs to the CSN8 family.
Sequence	MPVAVMAESAFSFKKLLDQCENQELEAPGGIATPPVYGQLLALYLLHNDMNNARYLWKRIPPAIKSANSELGGIWSVGQRIWQRDFPGIYTTINAHQWSETVQPIMEALRDATRRRAFALVSQAYTSIIADDFAAFVGLPVEEAVKGILEQGWQADSTTRMVLPRKPVAGALDVSFNKFIPLSEPAPVPPIPNEQQLARLTDYVAFLEN Show more

Gene and Protein Information

Species	Gene ID	Gene Symbol	Gene Name	Uniprot
HUMAN	10920	COPS8	COP9 signalosome complex subunit 8	Q99627
MOUSE	108679	Cops8	COP9 signalosome complex subunit 8	Q8VBV7
MOUSE		Cops8	COP9 signalosome complex subunit 8	A0A087WPM5
RAT	363283	Cops8	COP9 signalosome complex subunit 8	Q6P4Z9

Protein Classes

PANTHER Classes
protein / signaling molecule / COP9 signalosome complex subunit 8

DTO Classes
protein / Signaling / COP9 signalosome complex subunit 8

Associated Recombinant Proteins

Name	Specification and purity	Expression system	Protein label	Activity	View Details

Associated Antibodies

Name	Specifications	Species reactivity	species	Application	View Details

Associated Approved Drugs

Associated Active Ligands

Associated Diseases

Name	Disease Type	Mondoid

Pathway

Data Source	Name	Explore more targets	Explore in Source

Source: DataSourcesLicenses.xlsx