The store will not work correctly when cookies are disabled.
CYP2E1
| Description | Cytochrome P450 2E1 |
|---|
Gene and Protein Information
| Gene ID | 1571 |
|---|
| Uniprot Accession IDs | Q5VZD5 Q6NWT9 Q9UK47 |
|---|
| Ensembl ID | ENSP00000440689 |
|---|
| Symbol | CYP2E CPE1 CYP2E P450-J P450C2E |
|---|
| Family | Belongs to the cytochrome P450 family. |
|---|
| Sequence | MSALGVTVALLVWAAFLLLVSMWRQVHSSWNLPPGPFPLPIIGNLFQLELKNIPKSFTRLAQRFGPVFTLYVGSQRMVVMHGYKAVKEALLDYKDEFSGRGDLPAFHAHRDRGIIFNNGPTWKDIRRFSLTTLRNYGMGKQGNESRIQREAHFLLEALRKTQGQPFDPTFLIGCAPCNVIADILFRKHFDYNDEKFLRLMYLFNENFHLLSTPWLQLYNNFPSFLHYLPGSHRKVIKNVAEVKEYVSERVKEHHQSLDPNCPRDLTDCLLVEMEKEKHSAERLYTMDGITVTVADLFFAGTETTSTTLRYGLLILMKYPEIEEKLHEEIDRVIGPSRIPAIKDRQEMPYMDAVVHEIQRFITLVPSNLPHEATRDTIFRGYLIPKGTVVVPTLDSVLYDNQEFPDPEKFKPEHFLNENGKFKYSDYFKPFSTGKRVCAGEGLARMELFLLLCAILQHFNLKPLVDPKDIDLSPIHIGFGCIPPRYKLCVIPRS Show more |
|---|
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|
| Chimp | 450857 | CYP2E1 | cytochrome P450 family 2 subfamily E member 1 | 9598 | VGNC:6152 | OMA, EggNOG |
| Mouse | 13106 | Cyp2e1 | cytochrome P450, family 2, subfamily e, polypeptide 1 | 10090 | MGI:88607 | Inparanoid, OMA, EggNOG |
| Rat | 25086 | Cyp2e1 | cytochrome P450, family 2, subfamily e, polypeptide 1 | 10116 | RGD:2475 | Inparanoid, OMA, EggNOG |
| Dog | 415128 | CYP2E1 | cytochrome P450 family 2 subfamily E member 1 | 9615 | VGNC:50353 | Inparanoid, OMA |
| Horse | 100066422 | CYP2E1 | cytochrome P450 family 2 subfamily E member 1 | 9796 | VGNC:50568 | Inparanoid, OMA |
| Cow | 282213 | CYP2E1 | cytochrome P450, family 2, subfamily E, polypeptide 1 | 9913 | | Inparanoid, OMA |
| Pig | 403216 | CYP2E1 | cytochrome P450, family 2, subfamily E, polypeptide 1 | 9823 | | Inparanoid, OMA |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
