The store will not work correctly when cookies are disabled.
CSNK2B
Description | Casein kinase II subunit beta |
---|
Gene and Protein Information
Gene ID | 1460 |
Uniprot Accession IDs | B0UXA9 P07312 P13862 Q4VX47 CK II beta |
Ensembl ID | ENSP00000365042 |
Symbol | CK2N G5A G5A CK2B CK2N Ckb1 Ckb2 CSK2B |
Family | Belongs to the casein kinase 2 subunit beta family. |
Sequence | MSSSEEVSWISWFCGLRGNEFFCEVDEDYIQDKFNLTGLNEQVPHYRQALDMILDLEPDEELEDNPNQSDLIEQAAEMLYGLIHARYILTNRGIAQMLEKYQQGDFGYCPRVYCENQPMLPIGLSDIPGEAMVKLYCPKCMDVYTPKSSRHHHTDGAYFGTGFPHMLFMVHPEYRPKRPANQFVPRLYGFKIHPMAYQLQLQAASNFKSPVKTIR |
---|
Homologous gene and protein info.
Associated Recombinant Proteins
Name | Specification and purity | Expression system | Protein label | Activity | View Details |
---|
Associated Antibodies
Name | Specifications | Species reactivity | species | Application | View Details |
---|
Associated Approved Drugs
Associated Active Ligands
Pathway
Data Source | Name | Explore more targets | Explore in Source |
---|