The store will not work correctly when cookies are disabled.
CRTC3
| Description | CREB-regulated transcription coactivator 3 |
|---|
Gene and Protein Information
| Gene ID | 64784 |
|---|
| Uniprot Accession IDs | Q6DK61 Q6DK62 Q8NF38 Q9H6U2 |
|---|
| Ensembl ID | ENSP00000268184 |
|---|
| Symbol | TORC3 TORC3 TORC-3 |
|---|
| Family | Belongs to the TORC family. |
|---|
| Sequence | MAASPGSGSANPRKFSEKIALHTQRQAEETRAFEQLMTDLTLSRVQFQKLQQLRLTQYHGGSLPNVSQLRSSASEFQPSFHQADNVRGTRHHGLVERPSRNRFHPLHRRSGDKPGRQFDGSAFGANYSSQPLDESWPRQQPPWKDEKHPGFRLTSALNRTNSDSALHTSALSTKPQDPYGGGGQSAWPAPYMGFCDGENNGHGEVASFPGPLKEENLLNVPKPLPKQLWETKEIQSLSGRPRSCDVGGGNAFPHNGQNLGLSPFLGTLNTGGSLPDLTNLHYSTPLPASLDTTDHHFGSMSVGNSVNNIPAAMTHLGIRSSSGLQSSRSNPSIQATLNKTVLSSSLNNHPQTSVPNASALHPSLRLFSLSNPSLSTTNLSGPSRRRQPPVSPLTLSPGPEAHQGFSRQLSSTSPLAPYPTSQMVSSDRSQLSFLPTEAQAQVSPPPPYPAPQELTQPLLQQPRAPEAPAQQPQAASSLPQSDFQLLPAQGSSLTNFFPDVGFDQQSMRPGPAFPQQVPLVQQGSRELQDSFHLRPSPYSNCGSLPNTILPEDSSTSLFKDLNSALAGLPEVSLNVDTPFPLEEELQIEPLSLDGLNMLSDSSMGLLDPSVEETFRADRL Show more |
|---|
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|
| Chimp | 453648 | CRTC3 | CREB regulated transcription coactivator 3 | 9598 | VGNC:11847 | OMA, EggNOG |
| Macaque | 709458 | CRTC3 | CREB regulated transcription coactivator 3 | 9544 | | Inparanoid, OMA, EggNOG |
| Mouse | 70461 | Crtc3 | CREB regulated transcription coactivator 3 | 10090 | MGI:1917711 | Inparanoid, OMA, EggNOG |
| Rat | 365297 | Crtc3 | CREB regulated transcription coactivator 3 | 10116 | RGD:1309666 | Inparanoid, OMA, EggNOG |
| Dog | 488747 | CRTC3 | CREB regulated transcription coactivator 3 | 9615 | VGNC:53163 | Inparanoid, OMA, EggNOG |
| Horse | 100068775 | CRTC3 | CREB regulated transcription coactivator 3 | 9796 | VGNC:50664 | Inparanoid, OMA, EggNOG |
| Cow | 540109 | CRTC3 | CREB regulated transcription coactivator 3 | 9913 | VGNC:27729 | Inparanoid, OMA, EggNOG |
| Opossum | 100013995 | CRTC3 | CREB regulated transcription coactivator 3 | 13616 | | Inparanoid, EggNOG |
| Xenopus | 496857 | crtc3 | CREB regulated transcription coactivator 3 | 8364 | XB-GENE-5787077 | Inparanoid, OMA, EggNOG |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
