The store will not work correctly when cookies are disabled.
Protein or Target Summary
ADP-ribosylation factor 1
| Gene ID | 375 |
|---|
| uniprot | P84077 |
|---|
| Gene Name | ARF1 |
|---|
| Ensernbl ID | ENSP00000440005 |
|---|
| Family | Belongs to the small GTPase superfamily. Arf family. |
|---|
| Sequence | MGNIFANLFKGLFGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLAEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRHRNWYIQATCATSGDGLYEGLDWLSNQLRNQK Show more |
|---|
Gene and Protein Information
| Species | Gene ID | Gene Symbol | Gene Name | Uniprot |
|---|
| HUMAN | 375 | ARF1 | ADP-ribosylation factor 1 | P84077 |
| MOUSE | 11840 | Arf1 | ADP-ribosylation factor 1 | P84078 |
| RAT | 64310 | Arf1 | ADP-ribosylation factor 1 | P84079 |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
