The store will not work correctly when cookies are disabled.
ARF1
| Description | ADP-ribosylation factor 1 |
|---|
Gene and Protein Information
| Gene ID | 375 |
|---|
| Uniprot Accession IDs | P10947 P32889 |
|---|
| Ensembl ID | ENSP00000440005 |
|---|
| Symbol | PVNH8 |
|---|
| Family | Belongs to the small GTPase superfamily. Arf family. |
|---|
| Sequence | MGNIFANLFKGLFGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLAEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRHRNWYIQATCATSGDGLYEGLDWLSNQLRNQK |
|---|
Homologous gene and protein info.
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
