The store will not work correctly when cookies are disabled.
DEGS1
| Description | Sphingolipid delta(4)-desaturase DES1 |
|---|
Gene and Protein Information
| Gene ID | 8560 |
|---|
| Uniprot Accession IDs | O15121 |
|---|
| Ensembl ID | ENSP00000316476 |
|---|
| Symbol | DES1 MLD MLD DEGS DES1 Des-1 FADS7 MIG15 DEGS-1 |
|---|
| Family | Belongs to the fatty acid desaturase type 1 family. DEGS subfamily. |
|---|
| Sequence | MGSRVSREDFEWVYTDQPHADRRREILAKYPEIKSLMKPDPNLIWIIIMMVLTQLGAFYIVKDLDWKWVIFGAYAFGSCINHSMTLAIHEIAHNAAFGNCKAMWNRWFGMFANLPIGIPYSISFKRYHMDHHRYLGADGVDVDIPTDFEGWFFCTAFRKFIWVILQPLFYAFRPLFINPKPITYLEVINTVAQVTFDILIYYFLGIKSLVYMLAASLLGLGLHPISGHFIAEHYMFLKGHETYSYYGPLNLLTFNVGYHNEHHDFPNIPGKSLPLVRKIAAEYYDNLPHYNSWIKVLYDFVMDDTISPYSRMKRHQKGEMVLE Show more |
|---|
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|
| Chimp | 457770 | DEGS1 | delta 4-desaturase, sphingolipid 1 | 9598 | VGNC:8250 | OMA, EggNOG |
| Macaque | 702128 | DEGS1 | delta 4-desaturase, sphingolipid 1 | 9544 | | Inparanoid, OMA, EggNOG |
| Mouse | 13244 | Degs1 | delta(4)-desaturase, sphingolipid 1 | 10090 | MGI:1097711 | Inparanoid, OMA, EggNOG |
| Rat | 58970 | Degs1 | delta(4)-desaturase, sphingolipid 1 | 10116 | RGD:70917 | Inparanoid, OMA, EggNOG |
| Dog | 490395 | DEGS1 | delta 4-desaturase, sphingolipid 1 | 9615 | VGNC:49678 | Inparanoid, OMA, EggNOG |
| Horse | 100055442 | DEGS1 | delta 4-desaturase, sphingolipid 1 | 9796 | VGNC:17117 | Inparanoid, OMA, EggNOG |
| Cow | 507290 | DEGS1 | delta 4-desaturase, sphingolipid 1 | 9913 | VGNC:27990 | Inparanoid, OMA, EggNOG |
| Pig | 100135677 | DEGS1 | delta 4-desaturase, sphingolipid 1 | 9823 | | Inparanoid, OMA, EggNOG |
| Opossum | 100018776 | DEGS1 | delta 4-desaturase, sphingolipid 1 | 13616 | | Inparanoid, OMA, EggNOG |
| Platypus | 100081682 | DEGS1 | delta 4-desaturase, sphingolipid 1 | 9258 | | Inparanoid, OMA, EggNOG |
| Chicken | 421327 | DEGS1 | delta 4-desaturase, sphingolipid 1 | 9031 | CGNC:51468 | Inparanoid, OMA |
| Anole lizard | 100551856 | degs1 | delta 4-desaturase, sphingolipid 1 | 28377 | | Inparanoid, OMA |
| Xenopus | 493214 | degs1 | delta(4)-desaturase, sphingolipid 1 | 8364 | XB-GENE-946874 | Inparanoid, OMA |
| Zebrafish | 327075 | degs1 | delta(4)-desaturase, sphingolipid 1 | 7955 | ZDB-GENE-030131-5283 | Inparanoid, OMA |
| C. elegans | 173327 | ttm-5 | Putative sphingolipid delta(4)-desaturase/C4-monooxygenase | 6239 | | Inparanoid, OMA |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
