The store will not work correctly when cookies are disabled.
DCTD
| Description | Deoxycytidylate deaminase |
|---|
Gene and Protein Information
| Gene ID | 1635 |
|---|
| Uniprot Accession IDs | B2R836 D3DP49 D3DP50 Q5M7Z8 Q9BVD8 |
|---|
| Ensembl ID | ENSP00000349576 |
|---|
| Family | Belongs to the cytidine and deoxycytidylate deaminase family. |
|---|
| Sequence | MSEVSCKKRDDYLEWPEYFMAVAFLSAQRSKDPNSQVGACIVNSENKIVGIGYNGMPNGCSDDVLPWRRTAENKLDTKYPYVCHAELNAIMNKNSTDVKGCSMYVALFPCNECAKLIIQAGIKEVIFMSDKYHDSDEATAARLLFNMAGVTFRKFIPKCSKIVIDFDSINSRPSQKLQ |
|---|
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|
| Chimp | 461620 | DCTD | dCMP deaminase | 9598 | VGNC:10854 | OMA, EggNOG |
| Macaque | 700995 | DCTD | dCMP deaminase | 9544 | | Inparanoid, OMA, EggNOG |
| Mouse | 320685 | Dctd | dCMP deaminase | 10090 | MGI:2444529 | Inparanoid, OMA, EggNOG |
| Rat | 290741 | Dctd | dCMP deaminase | 10116 | RGD:1359671 | Inparanoid, OMA, EggNOG |
| Dog | 607328 | DCTD | dCMP deaminase | 9615 | VGNC:39815 | Inparanoid, OMA, EggNOG |
| Horse | 100051279 | DCTD | dCMP deaminase | 9796 | VGNC:17054 | Inparanoid, OMA, EggNOG |
| Cow | 784292 | DCTD | dCMP deaminase | 9913 | VGNC:27927 | Inparanoid, OMA, EggNOG |
| Pig | 100154836 | DCTD | dCMP deaminase | 9823 | | OMA, EggNOG |
| Opossum | 100016351 | DCTD | dCMP deaminase | 13616 | | Inparanoid, OMA, EggNOG |
| Platypus | 100091521 | DCTD | dCMP deaminase | 9258 | | Inparanoid, OMA, EggNOG |
| Chicken | 422556 | DCTD | dCMP deaminase | 9031 | CGNC:8110 | Inparanoid, OMA, EggNOG |
| Anole lizard | 100566255 | dctd | dCMP deaminase | 28377 | | Inparanoid, OMA, EggNOG |
| Xenopus | 549019 | dctd | dCMP deaminase | 8364 | XB-GENE-971992 | Inparanoid, OMA, EggNOG |
| Zebrafish | 550332 | dctd | dCMP deaminase | 7955 | ZDB-GENE-050417-116 | Inparanoid, OMA, EggNOG |
| C. elegans | 191373 | ZK643.2 | Probable deoxycytidylate deaminase | 6239 | | Inparanoid, EggNOG |
| Fruitfly | 40222 | CG6951 | CG6951 gene product from transcript CG6951-RB | 7227 | FBgn0036959 | Inparanoid, EggNOG |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
