The store will not work correctly when cookies are disabled.
Protein or Target Summary
dCTP pyrophosphatase 1
| Gene ID | 79077 |
|---|
| uniprot | Q9H773 |
|---|
| Gene Name | DCTPP1 |
|---|
| Ensernbl ID | ENSP00000322524 |
|---|
| Sequence | MSVAGGEIRGDTGGEDTAAPGRFSFSPEPTLEDIRRLHAEFAAERDWEQFHQPRNLLLALVGEVGELAELFQWKTDGEPGPQGWSPRERAALQEELSDVLIYLVALAARCRVDLPLAVLSKMDINRRRYPAHLARSSSRKYTELPHGAISEDQAVGPADIPCDSTGQTST Show more |
|---|
Gene and Protein Information
| Species | Gene ID | Gene Symbol | Gene Name | Uniprot |
|---|
| HUMAN | 79077 | DCTPP1 | dCTP pyrophosphatase 1 | Q9H773 |
| MOUSE | 66422 | Dctpp1 | dCTP pyrophosphatase 1 | Q9QY93 |
| RAT | 192252 | Dctpp1 | dCTP pyrophosphatase 1 | Q91VC0 |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
