JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

྾

EDN2

Description	Endothelin-2

Gene and Protein Information

Gene ID	1907
Uniprot Accession IDs	Q5T1R3 ET-2
Ensembl ID	ENSP00000361668
Symbol	ET2 ET-2 PPET2
Family	Belongs to the endothelin/sarafotoxin family.
Sequence	MVSVPTTWCSVALALLVALHEGKGQAAATLEQPASSSHAQGTHLRLRRCSCSSWLDKECVYFCHLDIIWVNTPEQTAPYGLGNPPRRRRRSLPRRCQCSSARDPACATFCLRRPWTEAGAVPSRKSPADVFQTGKTGATTGELLQRLRDISTVKSLFAKRQQEAMREPRSTHSRWRKR

Homologous gene and protein info.

Species	Gene ID	Gene Symbol	Name	Tax ID	Other Gene ID	Sources
Chimp	469298	EDN2	endothelin 2	9598	VGNC:527	OMA, EggNOG
Macaque	695960	EDN2	endothelin 2	9544		Inparanoid, OMA, EggNOG
Mouse	13615	Edn2	endothelin 2	10090	MGI:95284	Inparanoid, OMA, EggNOG
Rat	24324	Edn2	endothelin 2	10116	RGD:2533	Inparanoid, OMA, EggNOG
Dog	403508	EDN2	endothelin 2	9615	VGNC:40200	Inparanoid, OMA, EggNOG
Horse		EDN2	endothelin 2 [Source:HGNC Symbol;Acc:HGNC:3177]	9796		OMA, EggNOG
Cow	319094	EDN2	endothelin 2	9913	VGNC:28328	Inparanoid, OMA, EggNOG
Opossum	100032585	EDN2	endothelin 2	13616		Inparanoid, OMA, EggNOG
Chicken	419559	EDN2	endothelin 2	9031	CGNC:421	Inparanoid, OMA, EggNOG
Zebrafish	569550	edn2	endothelin 2	7955	ZDB-GENE-060503-774	Inparanoid, EggNOG

PANTHER Classes
protein / signaling molecule / peptide hormone / Endothelin-2

DTO Classes
protein / Signaling / Hormone / Endothelin-2

Name	Specification and purity	Expression system	Protein label	Activity	View Details

Name	Specifications	Species reactivity	species	Application	View Details

Name	Disease Type	Mondoid

Data Source	Name	Explore more targets	Explore in Source