JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

Click Here for 5% Off Your First Aladdin Purchase!

྾

Protein or Target Summary

Growth/differentiation factor 8

Gene ID	2660
uniprot	O14793
Gene Name	MSTN
Ensernbl ID	ENSP00000260950
Family	Belongs to the TGF-beta family.
Sequence	MQKLQLCVYIYLFMLIVAGPVDLNENSEQKENVEKEGLCNACTWRQNTKSSRIEAIKIQILSKLRLETAPNISKDVIRQLLPKAPPLRELIDQYDVQRDDSSDGSLEDDDYHATTETIITMPTESDFLMQVDGKPKCCFFKFSSKIQYNKVVKAQLWIYLRPVETPTTVFVQILRLIKPMKDGTRYTGIRSLKLDMNPGTGIWQSIDVKTVLQNWLKQPESNLGIEIKALDENGHDLAVTFPGPGEDGLNPFLEVKVTDTPKRSRRDFGLDCDEHSTESRCCRYPLTVDFEAFGWDWIIAPKRYKANYCSGECEFVFLQKYPHTHLVHQANPRGSAGPCCTPTKMSPINMLYFNGKEQIIYGKIPAMVVDRCGCS Show more

Gene and Protein Information

Species	Gene ID	Gene Symbol	Gene Name	Uniprot
HUMAN	2660	MSTN	Growth/differentiation factor 8	O14793
MOUSE	17700	Mstn	Growth/differentiation factor 8	O08689
MOUSE		Mstn	Myostatin	Q0VGH1
MOUSE		Mstn	Growth/differentiation factor 8	A0A087WQL8
MOUSE		Mstn	Myostatin	Q3ZAS9
MOUSE	17700	Mstn	Growth differentiation factor 8	Q540E2
RAT	29152	Mstn	Growth/differentiation factor 8	O35312

Protein Classes

PANTHER Classes
protein / signaling molecule / growth factor / Growth/differentiation factor 8

DTO Classes
protein / Signaling / Growth factor / Growth/differentiation factor 8

Associated Recombinant Proteins

Name	Specification and purity	Expression system	Protein label	Activity	View Details

Associated Antibodies

Name	Specifications	Species reactivity	species	Application	View Details

Associated Approved Drugs

Associated Active Ligands

Associated Diseases

Name	Disease Type	Mondoid

Pathway

Data Source	Name	Explore more targets	Explore in Source

Source: DataSourcesLicenses.xlsx