Protein or Target Summary
Rho GDP-dissociation inhibitor 2
| Gene ID | 397 |
|---|---|
| uniprot | P52566 |
| Gene Name | ARHGDIB |
| Ensernbl ID | ENSP00000228945 |
| Family | Belongs to the Rho GDI family. |
| Sequence | MTEKAPEPHVEEDDDDELDSKLNYKPPPQKSLKELQEMDKDDESLIKYKKTLLGDGPVVTDPKAPNVVVTRLTLVCESAPGPITMDLTGDLEALKKETIVLKEGSEYRVKIHFKVNRDIVSGLKYVQHTYRTGVKVDKATFMVGSYGPRPEEYEFLTPVEEAPKGMLARGTYHNKSFFTDDDKQDHLSWEWNLSIKKEWTE Show more |
Gene and Protein Information
| Species | Gene ID | Gene Symbol | Gene Name | Uniprot |
|---|---|---|---|---|
| HUMAN | 397 | ARHGDIB | Rho GDP-dissociation inhibitor 2 | P52566 |
| MOUSE | 11857 | Arhgdib | Rho GDP-dissociation inhibitor 2 | Q61599 |
| MOUSE | Arhgdib | Rho GDP-dissociation inhibitor 2 | A0A0N4SVH4 | |
| MOUSE | Arhgdib | Rho GDP-dissociation inhibitor 2 | D3YWL7 | |
| RAT | 362456 | Arhgdib | Rho GDP dissociation inhibitor beta | Q5M860 |
Protein Classes
PANTHER Classes
protein / enzyme modulator / G-protein modulator / Rho GDP-dissociation inhibitor 2
protein / enzyme modulator / signaling molecule / Rho GDP-dissociation inhibitor 2
protein / enzyme modulator / G-protein modulator / Rho GDP-dissociation inhibitor 2
protein / enzyme modulator / signaling molecule / Rho GDP-dissociation inhibitor 2
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Disease Type | Mondoid |
|---|
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
Source: DataSourcesLicenses.xlsx