The store will not work correctly when cookies are disabled.
Gene and Protein Information
| Gene ID | 51053 |
|---|
| Uniprot Accession IDs | B3KMM8 Q9H1Z1 |
|---|
| Ensembl ID | ENSP00000230056 |
|---|
| Symbol | Gem MGORS6 |
|---|
| Family | Belongs to the geminin family. |
|---|
| Sequence | MNPSMKQKQEEIKENIKNSSVPRRTLKMIQPSASGSLVGRENELSAGLSKRKHRNDHLTSTTSSPGVIVPESSENKNLGGVTQESFDLMIKENPSSQYWKEVAEKRRKALYEALKENEKLHKEIEQKDNEIARLKKENKELAEVAEHVQYMAELIERLNGEPLDNFESLDNQEFDSEEETVEDSLVEDSEIGTCAEGTVSSSTDAKPCI |
|---|
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|
| Chimp | 462477 | GMNN | geminin, DNA replication inhibitor | 9598 | VGNC:7891 | OMA, EggNOG |
| Macaque | 708416 | GMNN | geminin, DNA replication inhibitor | 9544 | | Inparanoid, OMA, EggNOG |
| Mouse | 57441 | Gmnn | geminin | 10090 | MGI:1927344 | Inparanoid, OMA, EggNOG |
| Rat | 291137 | Gmnn | geminin, DNA replication inhibitor | 10116 | RGD:1308137 | Inparanoid, OMA, EggNOG |
| Dog | 478739 | GMNN | geminin, DNA replication inhibitor | 9615 | VGNC:41291 | Inparanoid, OMA, EggNOG |
| Horse | 100052598 | GMNN | geminin, DNA replication inhibitor | 9796 | VGNC:18408 | Inparanoid, OMA, EggNOG |
| Cow | 526377 | GMNN | geminin, DNA replication inhibitor | 9913 | VGNC:29439 | Inparanoid, OMA, EggNOG |
| Pig | 100515035 | GMNN | geminin, DNA replication inhibitor | 9823 | | OMA, EggNOG |
| Opossum | 100024101 | GMNN | geminin, DNA replication inhibitor | 13616 | | Inparanoid, OMA, EggNOG |
| Platypus | | GMNN | geminin, DNA replication inhibitor [Source:HGNC Symbol;Acc:HGNC:17493] | 9258 | | OMA, EggNOG |
| Chicken | 421004 | GMNN | geminin, DNA replication inhibitor | 9031 | CGNC:10213 | Inparanoid, OMA, EggNOG |
| Xenopus | 496859 | gmnn | geminin, DNA replication inhibitor | 8364 | XB-GENE-966994 | Inparanoid, OMA, EggNOG |
| Zebrafish | 368320 | gmnn | geminin, DNA replication inhibitor | 7955 | ZDB-GENE-030429-30 | Inparanoid, EggNOG |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
