Call +1 (833) 552-7181 or Contact us Earn $25 in coupons on your first order with Aladdin!
Toggle Nav
My Cart
Search
Advanced Search
Menu
Sign In
྾

GMNN

DescriptionGeminin

Gene and Protein Information

Gene ID51053
Uniprot Accession IDs B3KMM8 Q9H1Z1
Ensembl ID ENSP00000230056
Symbol Gem MGORS6
FamilyBelongs to the geminin family.
Sequence
MNPSMKQKQEEIKENIKNSSVPRRTLKMIQPSASGSLVGRENELSAGLSKRKHRNDHLTSTTSSPGVIVPESSENKNLGGVTQESFDLMIKENPSSQYWKEVAEKRRKALYEALKENEKLHKEIEQKDNEIARLKKENKELAEVAEHVQYMAELIERLNGEPLDNFESLDNQEFDSEEETVEDSLVEDSEIGTCAEGTVSSSTDAKPCI
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameTax IDOther Gene IDSources
Chimp462477GMNNgeminin, DNA replication inhibitor9598VGNC:7891OMA, EggNOG
Macaque708416GMNNgeminin, DNA replication inhibitor9544Inparanoid, OMA, EggNOG
Mouse57441Gmnngeminin10090MGI:1927344Inparanoid, OMA, EggNOG
Rat291137Gmnngeminin, DNA replication inhibitor10116RGD:1308137Inparanoid, OMA, EggNOG
Dog478739GMNNgeminin, DNA replication inhibitor9615VGNC:41291Inparanoid, OMA, EggNOG
Horse100052598GMNNgeminin, DNA replication inhibitor9796VGNC:18408Inparanoid, OMA, EggNOG
Cow526377GMNNgeminin, DNA replication inhibitor9913VGNC:29439Inparanoid, OMA, EggNOG
Pig100515035GMNNgeminin, DNA replication inhibitor9823OMA, EggNOG
Opossum100024101GMNNgeminin, DNA replication inhibitor13616Inparanoid, OMA, EggNOG
PlatypusGMNNgeminin, DNA replication inhibitor [Source:HGNC Symbol;Acc:HGNC:17493]9258OMA, EggNOG
Chicken421004GMNNgeminin, DNA replication inhibitor9031CGNC:10213Inparanoid, OMA, EggNOG
Xenopus496859gmnngeminin, DNA replication inhibitor8364XB-GENE-966994Inparanoid, OMA, EggNOG
Zebrafish368320gmnngeminin, DNA replication inhibitor7955ZDB-GENE-030429-30Inparanoid, EggNOG

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelActivityView Details

Associated Antibodies

NameSpecificationsSpecies reactivityspeciesApplicationView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDisease TypeMondoid

      Pathway

      Data SourceNameExplore more targetsExplore in Source
      🔙[Back to Target (Human)]
      Privacy Policy Website Terms of Use Return policy Terms and Conditions of Sale Cookie Policy Sales Policy
      Products are chemical reagents for research use only and are not intended for human use. We do not sell to patients.
      Copyright © 2023-present Aladdin Scientific Corp . All rights reserved.