TSFM
| Description | Elongation factor Ts, mitochondrial |
|---|
Gene and Protein Information
| Gene ID | 10102 |
|---|---|
| Uniprot Accession IDs | B4E391 F5H2T7 Q561V7 Q8TBC2 Q9UQK0 EF-Ts |
| Ensembl ID | ENSP00000313877 |
| Symbol | EFTS EFTSMT |
| Family | Belongs to the EF-Ts family. |
| Sequence | MSLLRSLRVFLVARTGSYPAGSLLRQSPQPRHTFYAGPRLSASASSKELLMKLRRKTGYSFVNCKKALETCGGDLKQAEIWLHKEAQKEGWSKAAKLQGRKTKEGLIGLLQEGNTTVLVEVNCETDFVSRNLKFQLLVQQVALGTMMHCQTLKDQPSAYSKGFLNSSELSGLPAGPDREGSLKDQLALAIGKLGENMILKRAAWVKVPSGFYVGSYVHGAMQSPSLHKLVLGKYGALVICETSEQKTNLEDVGRRLGQHVVGMAPLSVGSLDDEPGGEAETKMLSQPYLLDPSITLGQYVQPQGVSVVDFVRFECGEGEEAAETE Show more |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 452028 | TSFM | Ts translation elongation factor, mitochondrial | 9598 | VGNC:14418 | OMA, EggNOG |
| Macaque | 715916 | TSFM | Ts translation elongation factor, mitochondrial | 9544 | Inparanoid, OMA, EggNOG | |
| Mouse | 66399 | Tsfm | Ts translation elongation factor, mitochondrial | 10090 | MGI:1913649 | Inparanoid, OMA, EggNOG |
| Rat | 679068 | Tsfm | Ts translation elongation factor, mitochondrial | 10116 | RGD:1593058 | Inparanoid, OMA |
| Horse | 100053864 | TSFM | Ts translation elongation factor, mitochondrial | 9796 | VGNC:24576 | Inparanoid, OMA, EggNOG |
| Cow | 281551 | TSFM | Ts translation elongation factor, mitochondrial | 9913 | VGNC:36413 | Inparanoid, OMA, EggNOG |
| Opossum | 100031520 | TSFM | Ts translation elongation factor, mitochondrial | 13616 | Inparanoid, OMA, EggNOG | |
| Anole lizard | 100566410 | tsfm | Ts translation elongation factor, mitochondrial | 28377 | OMA, EggNOG | |
| Xenopus | tsfm | Ts translation elongation factor, mitochondrial [Source:Xenbase;Acc:XB-GENE-964861] | 8364 | OMA, EggNOG | ||
| Zebrafish | 567785 | tsfm | Ts translation elongation factor, mitochondrial | 7955 | ZDB-GENE-061215-17 | Inparanoid, OMA, EggNOG |
| C. elegans | 179683 | tsfm-1 | Elongation factor Ts, mitochondrial | 6239 | Inparanoid, OMA, EggNOG | |
| Fruitfly | 35060 | CG6412 | CG6412 gene product from transcript CG6412-RA | 7227 | FBgn0032646 | Inparanoid, OMA, EggNOG |
Protein Classes
PANTHER Classes
protein / nucleic acid binding / guanyl-nucleotide exchange factor / Elongation factor Ts, mitochondrial
protein / nucleic acid binding / translation elongation factor / Elongation factor Ts, mitochondrial
protein / nucleic acid binding / guanyl-nucleotide exchange factor / Elongation factor Ts, mitochondrial
protein / nucleic acid binding / translation elongation factor / Elongation factor Ts, mitochondrial
DTO Classes
protein / Nucleic acid binding / RNA binding protein / Translation factor / Translation elongation factor / Elongation factor Ts, mitochondrial
protein / Nucleic acid binding / RNA binding protein / Translation factor / Translation elongation factor / Elongation factor Ts, mitochondrial
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Disease Type | Mondoid |
|---|
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|