Protein or Target Summary
Elongation factor Ts, mitochondrial
| Gene ID | 10102 |
|---|---|
| uniprot | P43897 |
| Gene Name | TSFM |
| Ensernbl ID | ENSP00000313877 |
| Family | Belongs to the EF-Ts family. |
| Sequence | MSLLRSLRVFLVARTGSYPAGSLLRQSPQPRHTFYAGPRLSASASSKELLMKLRRKTGYSFVNCKKALETCGGDLKQAEIWLHKEAQKEGWSKAAKLQGRKTKEGLIGLLQEGNTTVLVEVNCETDFVSRNLKFQLLVQQVALGTMMHCQTLKDQPSAYSKGFLNSSELSGLPAGPDREGSLKDQLALAIGKLGENMILKRAAWVKVPSGFYVGSYVHGAMQSPSLHKLVLGKYGALVICETSEQKTNLEDVGRRLGQHVVGMAPLSVGSLDDEPGGEAETKMLSQPYLLDPSITLGQYVQPQGVSVVDFVRFECGEGEEAAETE Show more |
Gene and Protein Information
| Species | Gene ID | Gene Symbol | Gene Name | Uniprot |
|---|---|---|---|---|
| HUMAN | 10102 | TSFM | Elongation factor Ts, mitochondrial | P43897 |
| MOUSE | 66399 | Tsfm | Elongation factor Ts, mitochondrial | Q9CZR8 |
| MOUSE | Tsfm | Translation elongation factor | Q8VDE3 | |
| MOUSE | Tsfm | Tsfm protein | Q80UT3 | |
| MOUSE | Tsfm | Tsfm protein | Q8K239 | |
| MOUSE | Tsfm | Elongation factor Ts, mitochondrial | D3Z4M7 | |
| MOUSE | Tsfm | Elongation factor Ts, mitochondrial | Q3TA37 | |
| MOUSE | Tsfm | Elongation factor Ts, mitochondrial | Q9CX33 | |
| MOUSE | Tsfm | Elongation factor Ts, mitochondrial | A0A1S6GWJ9 | |
| RAT | Tsfm | Elongation factor Ts, mitochondrial | Q9QYU2 | |
| RAT | Tsfm | Elongation factor Ts, mitochondrial | M0R4P2 |
Protein Classes
PANTHER Classes
protein / nucleic acid binding / guanyl-nucleotide exchange factor / Elongation factor Ts, mitochondrial
protein / nucleic acid binding / translation elongation factor / Elongation factor Ts, mitochondrial
protein / nucleic acid binding / guanyl-nucleotide exchange factor / Elongation factor Ts, mitochondrial
protein / nucleic acid binding / translation elongation factor / Elongation factor Ts, mitochondrial
DTO Classes
protein / Nucleic acid binding / RNA binding protein / Translation factor / Translation elongation factor / Elongation factor Ts, mitochondrial
protein / Nucleic acid binding / RNA binding protein / Translation factor / Translation elongation factor / Elongation factor Ts, mitochondrial
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Disease Type | Mondoid |
|---|
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|