PTPN7
| Description | Tyrosine-protein phosphatase non-receptor type 7 |
|---|
Gene and Protein Information
| Gene ID | 5778 |
|---|---|
| Uniprot Accession IDs | B3KXE1 Q53XK4 Q5SXQ0 Q5SXQ1 Q9BV05 |
| Ensembl ID | ENSP00000309116 |
| Symbol | LPTP HEPTP PTPNI BPTP-4 LC-PTP |
| Family | Belongs to the protein-tyrosine phosphatase family. Non-receptor class subfamily. |
| Sequence | MVQAHGGRSRAQPLTLSLGAAMTQPPPEKTPAKKHVRLQERRGSNVALMLDVRSLGAVEPICSVNTPREVTLHFLRTAGHPLTRWALQRQPPSPKQLEEEFLKIPSNFVSPEDLDIPGHASKDRYKTILPNPQSRVCLGRAQSQEDGDYINANYIRGYDGKEKVYIATQGPMPNTVSDFWEMVWQEEVSLIVMLTQLREGKEKCVHYWPTEEETYGPFQIRIQDMKECPEYTVRQLTIQYQEERRSVKHILFSAWPDHQTPESAGPLLRLVAEVEESPETAAHPGPIVVHCSAGIGRTGCFIATRIGCQQLKARGEVDILGIVCQLRLDRGGMIQTAEQYQFLHHTLALYAGQLPEEPSP Show more |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 739158 | PTPN7 | protein tyrosine phosphatase, non-receptor type 7 | 9598 | VGNC:9887 | OMA, EggNOG |
| Macaque | 706254 | PTPN7 | protein tyrosine phosphatase, non-receptor type 7 | 9544 | Inparanoid, OMA, EggNOG | |
| Mouse | 320139 | Ptpn7 | protein tyrosine phosphatase, non-receptor type 7 | 10090 | MGI:2156893 | Inparanoid, OMA, EggNOG |
| Rat | 246781 | Ptpn7 | protein tyrosine phosphatase, non-receptor type 7 | 10116 | RGD:708516 | Inparanoid, OMA, EggNOG |
| Dog | 607227 | PTPN7 | protein tyrosine phosphatase, non-receptor type 7 | 9615 | VGNC:45180 | Inparanoid, OMA, EggNOG |
| Horse | 100052261 | PTPN7 | protein tyrosine phosphatase, non-receptor type 7 | 9796 | VGNC:22024 | Inparanoid, OMA, EggNOG |
| Cow | 614077 | PTPN7 | protein tyrosine phosphatase, non-receptor type 7 | 9913 | VGNC:33542 | Inparanoid, OMA, EggNOG |
| Opossum | 100014659 | PTPN7 | protein tyrosine phosphatase, non-receptor type 7 | 13616 | Inparanoid, OMA, EggNOG | |
| Platypus | 100077157 | PTPN7 | protein tyrosine phosphatase, non-receptor type 7 | 9258 | Inparanoid, OMA, EggNOG | |
| Anole lizard | 100567068 | ptpn7 | protein tyrosine phosphatase, non-receptor type 7 | 28377 | Inparanoid, OMA, EggNOG |
Protein Classes
PANTHER Classes
protein / protein phosphatase / Tyrosine-protein phosphatase non-receptor type 7
protein / phosphatase / Tyrosine-protein phosphatase non-receptor type 7
protein / hydrolase / Tyrosine-protein phosphatase non-receptor type 7
protein / protein phosphatase / Tyrosine-protein phosphatase non-receptor type 7
protein / phosphatase / Tyrosine-protein phosphatase non-receptor type 7
protein / hydrolase / Tyrosine-protein phosphatase non-receptor type 7
DTO Classes
protein / Enzyme / Hydrolase / Phosphatase / Protein phosphatase / Tyrosine-protein phosphatase non-receptor type 7
protein / Enzyme / Hydrolase / Phosphatase / Protein phosphatase / Tyrosine-protein phosphatase non-receptor type 7
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Disease Type | Mondoid |
|---|
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|