The store will not work correctly when cookies are disabled.
RAD52
Description | DNA repair protein RAD52 homolog |
---|
Gene and Protein Information
Gene ID | 5893 |
Uniprot Accession IDs | Q13205 Q9Y5T7 Q9Y5T8 Q9Y5T9 |
Ensembl ID | ENSP00000351284 |
Family | Belongs to the RAD52 family. |
Sequence | MSGTEEAILGGRDSHPAAGGGSVLCFGQCQYTAEEYQAIQKALRQRLGPEYISSRMAGGGQKVCYIEGHRVINLANEMFGYNGWAHSITQQNVDFVDLNNGKFYVGVCAFVRVQLKDGSYHEDVGYGVSEGLKSKALSLEKARKEAVTDGLKRALRSFGNALGNCILDKDYLRSLNKLPRQLPLEVDLTKAKRQDLEPSVEEARYNSCRPNMALGHPQLQQVTSPSRPSHAVIPADQDCSSRSLSSSAVESEATHQRKLRQKQLQQQFRERMEKQQVRVSTPSAEKSEAAPPAPPVTHSTPVTVSEPLLEKDFLAGVTQELIKTLEDNSEKWAVTPDAGDGVVKPSSRADPAQTSDTLALNNQMVTQNRTPHSVCHQKPQAKSGSWDLQTYSADQRTTGNWESHRKSQDMKKRKYDPS Show more |
---|
Homologous gene and protein info.
Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
Chimp | 466911 | RAD52 | RAD52 homolog, DNA repair protein | 9598 | VGNC:5563 | OMA, EggNOG |
Macaque | 100426645 | RAD52 | RAD52 homolog (S. cerevisiae) | 9544 | | OMA, EggNOG |
Mouse | 19365 | Rad52 | RAD52 homolog, DNA repair protein | 10090 | MGI:101949 | Inparanoid, OMA, EggNOG |
Rat | 297561 | Rad52 | RAD52 homolog, DNA repair protein | 10116 | RGD:1304975 | Inparanoid, OMA, EggNOG |
Dog | 477729 | RAD52 | RAD52 homolog, DNA repair protein | 9615 | VGNC:45321 | Inparanoid, OMA, EggNOG |
Horse | 100050254 | RAD52 | RAD52 homolog, DNA repair protein | 9796 | VGNC:22150 | Inparanoid, OMA, EggNOG |
Cow | 512897 | RAD52 | RAD52 homolog, DNA repair protein | 9913 | VGNC:33688 | Inparanoid, OMA, EggNOG |
Pig | 100141308 | RAD52 | RAD52 homolog, DNA repair protein | 9823 | | OMA, EggNOG |
Opossum | 100020944 | RAD52 | RAD52 homolog, DNA repair protein | 13616 | | Inparanoid, EggNOG |
Xenopus | 100036666 | rad52 | RAD52 homolog, DNA repair protein | 8364 | XB-GENE-991154 | Inparanoid, EggNOG |
Zebrafish | 554171 | rad52 | RAD52 homolog, DNA repair protein | 7955 | ZDB-GENE-050731-10 | Inparanoid, EggNOG |
Associated Recombinant Proteins
Name | Specification and purity | Expression system | Protein label | Activity | View Details |
---|
Associated Antibodies
Name | Specifications | Species reactivity | species | Application | View Details |
---|
Associated Approved Drugs
Associated Active Ligands
Pathway
Data Source | Name | Explore more targets | Explore in Source |
---|