The store will not work correctly when cookies are disabled.
RAB27A
Description | Ras-related protein Rab-27A |
---|
Gene and Protein Information
Gene ID | 5873 |
Uniprot Accession IDs | O00195 Q6FI40 Q9UIR9 Q9Y5U3 Rab-27 |
Ensembl ID | ENSP00000379601 |
Symbol | RAB27 GS2 RAM RAB27 HsT18676 |
Family | Belongs to the small GTPase superfamily. Rab family. |
Sequence | MSDGDYDYLIKFLALGDSGVGKTSVLYQYTDGKFNSKFITTVGIDFREKRVVYRASGPDGATGRGQRIHLQLWDTAGQERFRSLTTAFFRDAMGFLLLFDLTNEQSFLNVRNWISQLQMHAYCENPDIVLCGNKSDLEDQRVVKEEEAIALAEKYGIPYFETSAANGTNISQAIEMLLDLIMKRMERCVDKSWIPEGVVRSNGHASTDQLSEEKEKGACGC |
---|
Homologous gene and protein info.
Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
Chimp | 453455 | RAB27A | RAB27A, member RAS oncogene family | 9598 | VGNC:7762 | OMA, EggNOG |
Macaque | 697741 | RAB27A | RAB27A, member RAS oncogene family | 9544 | | Inparanoid, OMA, EggNOG |
Mouse | 11891 | Rab27a | RAB27A, member RAS oncogene family | 10090 | MGI:1861441 | Inparanoid, OMA, EggNOG |
Rat | 50645 | Rab27a | RAB27A, member RAS oncogene family | 10116 | RGD:620918 | Inparanoid, OMA |
Dog | 608699 | RAB27A | RAB27A, member RAS oncogene family | 9615 | VGNC:45267 | Inparanoid, OMA, EggNOG |
Horse | 100054867 | RAB27A | RAB27A, member RAS oncogene family | 9796 | VGNC:22100 | Inparanoid, OMA, EggNOG |
Cow | 618035 | RAB27A | RAB27A, member RAS oncogene family | 9913 | | OMA, EggNOG |
Pig | 606749 | RAB27A | RAB27A, member RAS oncogene family | 9823 | | Inparanoid, OMA, EggNOG |
Opossum | 100020373 | RAB27A | RAB27A, member RAS oncogene family | 13616 | | Inparanoid, EggNOG |
Platypus | | RAB27A | RAB27A, member RAS oncogene family [Source:HGNC Symbol;Acc:HGNC:9766] | 9258 | | OMA, EggNOG |
Chicken | 415410 | RAB27A | RAB27A, member RAS oncogene family | 9031 | CGNC:3268 | Inparanoid, OMA, EggNOG |
Xenopus | 493339 | rab27a | RAB27A, member RAS oncogene family | 8364 | XB-GENE-490563 | Inparanoid, OMA, EggNOG |
Zebrafish | 570907 | rab27a | RAB27A, member RAS oncogene family | 7955 | ZDB-GENE-050913-46 | Inparanoid, OMA |
Associated Recombinant Proteins
Name | Specification and purity | Expression system | Protein label | Activity | View Details |
---|
Associated Antibodies
Name | Specifications | Species reactivity | species | Application | View Details |
---|
Associated Approved Drugs
Associated Active Ligands
Pathway
Data Source | Name | Explore more targets | Explore in Source |
---|