The store will not work correctly when cookies are disabled.
Protein or Target Summary
Ras-related protein Rab-27B
| Gene ID | 5874 |
|---|
| uniprot | O00194 |
|---|
| Gene Name | RAB27B |
|---|
| Ensernbl ID | ENSP00000262094 |
|---|
| Family | Belongs to the small GTPase superfamily. Rab family. |
|---|
| Sequence | MTDGDYDYLIKLLALGDSGVGKTTFLYRYTDNKFNPKFITTVGIDFREKRVVYNAQGPNGSSGKAFKVHLQLWDTAGQERFRSLTTAFFRDAMGFLLMFDLTSQQSFLNVRNWMSQLQANAYCENPDIVLIGNKADLPDQREVNERQARELADKYGIPYFETSAATGQNVEKAVETLLDLIMKRMEQCVEKTQIPDTVNGGNSGNLDGEKPPEKKCIC Show more |
|---|
Gene and Protein Information
| Species | Gene ID | Gene Symbol | Gene Name | Uniprot |
|---|
| HUMAN | 5874 | RAB27B | Ras-related protein Rab-27B | O00194 |
| MOUSE | | Rab27b | RAB27b, member RAS oncogene family | Q4VA90 |
| MOUSE | 80718 | Rab27b | Rab27b protein | Q05D38 |
| MOUSE | 80718 | Rab27b | RAB27b, member RAS oncogene family, isoform CRA_a | Q549X4 |
| MOUSE | 80718 | Rab27b | Ras-related protein Rab-27B | Q99P58 |
| RAT | 84590 | Rab27b | Ras-related protein Rab-27B | Q99P74 |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
