JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

Click Here for 5% Off Your First Aladdin Purchase!

྾

Protein or Target Summary

RNA-binding protein 8A

Gene ID	9939
uniprot	Q9Y5S9
Gene Name	RBM8A
Ensernbl ID	ENSP00000463058
Family	Belongs to the RBM8A family.
Sequence	MADVLDLHEAGGEDFAMDEDGDESIHKLKEKAKKRKGRGFGSEEGSRARMREDYDSVEQDGDEPGPQRSVEGWILFVTGVHEEATEEDIHDKFAEYGEIKNIHLNLDRRTGYLKGYTLVEYETYKEAQAAMEGLNGQDLMGQPISVDWCFVRGPPKGKRRGGRRRSRSPDRRRR Show more

Gene and Protein Information

Species	Gene ID	Gene Symbol	Gene Name	Uniprot
HUMAN	9939	RBM8A	RNA-binding protein 8A	Q9Y5S9
MOUSE	60365	Rbm8a	RNA-binding protein 8A	Q9CWZ3
MOUSE		Rbm8a	RNA-binding protein 8A	A0A0G2JEA9
MOUSE		Rbm8a	RNA-binding protein 8A	A0A0G2JFX7
RAT	295284	Rbm8a	RNA-binding protein 8A	Q27W01

Associated Recombinant Proteins

Name	Specification and purity	Expression system	Protein label	Activity	View Details

Associated Antibodies

Name	Specifications	Species reactivity	species	Application	View Details

Associated Approved Drugs

Associated Active Ligands

Associated Diseases

Name	Disease Type	Mondoid

Pathway

Data Source	Name	Explore more targets	Explore in Source

Source: DataSourcesLicenses.xlsx