The store will not work correctly when cookies are disabled.
Protein or Target Summary
Ras-related protein Rab-5A
| Gene ID | 5868 |
|---|
| uniprot | P20339 |
|---|
| Gene Name | RAB5A |
|---|
| Ensernbl ID | ENSP00000273047 |
|---|
| Family | Belongs to the small GTPase superfamily. Rab family. |
|---|
| Sequence | MASRGATRPNGPNTGNKICQFKLVLLGESAVGKSSLVLRFVKGQFHEFQESTIGAAFLTQTVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNEESFARAKNWVKELQRQASPNIVIALSGNKADLANKRAVDFQEAQSYADDNSLLFMETSAKTSMNVNEIFMAIAKKLPKNEPQNPGANSARGRGVDLTEPTQPTRNQCCSN Show more |
|---|
Gene and Protein Information
| Species | Gene ID | Gene Symbol | Gene Name | Uniprot |
|---|
| HUMAN | 5868 | RAB5A | Ras-related protein Rab-5A | P20339 |
| MOUSE | 271457 | Rab5a | Ras-related protein Rab-5A | Q9CQD1 |
| MOUSE | | Rab5a | Uncharacterized protein | Q8CBH3 |
| RAT | | Rab5a | Rab5a protein | Q6IN17 |
| RAT | 64633 | Rab5a | Ras-related protein Rab-5A | M0RC99 |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
