The store will not work correctly when cookies are disabled.
RAB5A
| Description | Ras-related protein Rab-5A |
|---|
Gene and Protein Information
| Gene ID | 5868 |
|---|
| Uniprot Accession IDs | B4DJA5 Q6FI44 |
|---|
| Ensembl ID | ENSP00000273047 |
|---|
| Symbol | RAB5 RAB5 |
|---|
| Family | Belongs to the small GTPase superfamily. Rab family. |
|---|
| Sequence | MASRGATRPNGPNTGNKICQFKLVLLGESAVGKSSLVLRFVKGQFHEFQESTIGAAFLTQTVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNEESFARAKNWVKELQRQASPNIVIALSGNKADLANKRAVDFQEAQSYADDNSLLFMETSAKTSMNVNEIFMAIAKKLPKNEPQNPGANSARGRGVDLTEPTQPTRNQCCSN |
|---|
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|
| Chimp | 460217 | RAB5A | RAB5A, member RAS oncogene family | 9598 | VGNC:9693 | OMA, EggNOG |
| Macaque | 697712 | RAB5A | RAB5A, member RAS oncogene family | 9544 | | Inparanoid, OMA, EggNOG |
| Mouse | 271457 | Rab5a | RAB5A, member RAS oncogene family | 10090 | MGI:105926 | Inparanoid, OMA, EggNOG |
| Dog | 404008 | RAB5A | RAB5A, member RAS oncogene family | 9615 | VGNC:45291 | Inparanoid, OMA, EggNOG |
| Horse | 100051997 | RAB5A | RAB5A, member RAS oncogene family | 9796 | VGNC:22124 | Inparanoid, OMA, EggNOG |
| Cow | 539764 | RAB5A | RAB5A, member RAS oncogene family | 9913 | VGNC:33658 | Inparanoid, OMA |
| Opossum | 100024447 | RAB5A | RAB5A, member RAS oncogene family | 13616 | | Inparanoid, OMA, EggNOG |
| Platypus | | RAB5A | RAB5A, member RAS oncogene family [Source:HGNC Symbol;Acc:HGNC:9783] | 9258 | | OMA, EggNOG |
| Chicken | 420649 | RAB5A | RAB5A, member RAS oncogene family | 9031 | CGNC:51310 | Inparanoid, OMA, EggNOG |
| Anole lizard | 100552994 | rab5a | RAB5A, member RAS oncogene family | 28377 | | Inparanoid, OMA |
| Xenopus | 493430 | rab5a | RAB5A, member RAS oncogene family | 8364 | XB-GENE-482011 | Inparanoid, OMA, EggNOG |
| Zebrafish | 337737 | rab5aa | RAB5A, member RAS oncogene family, a | 7955 | ZDB-GENE-030131-139 | OMA, EggNOG |
| Zebrafish | 393945 | rab5ab | RAB5A, member RAS oncogene family, b | 7955 | ZDB-GENE-040122-3 | Inparanoid, OMA |
| S.cerevisiae | 853884 | YPT52 | Rab family GTPase YPT52 | 4932 | S000001722 | OMA, EggNOG |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
