The store will not work correctly when cookies are disabled.
Your company account is blocked and you cannot place orders. If you have questions, please contact your company administrator.
CENPA
Description | Histone H3-like centromeric protein A |
---|
Gene and Protein Information
Gene ID | 1058 |
Uniprot Accession IDs | D6W544 Q53T74 Q9BVW2 |
Ensembl ID | ENSP00000336868 |
Symbol | CenH3 CENP-A |
Family | Belongs to the histone H3 family. |
Sequence | MGPRRRSRKPEAPRRRSPSPTPTPGPSRRGPSLGASSHQHSRRRQGWLKEIRKLQKSTHLLIRKLPFSRLAREICVKFTRGVDFNWQAQALLALQEAAEAFLVHLFEDAYLLTLHAGRVTLFPKDVQLARRIRGLEEGLG |
---|
Homologous gene and protein info.
Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
Chimp | 459086 | CENPA | centromere protein A | 9598 | VGNC:191 | OMA, EggNOG |
Macaque | 697312 | CENPA | centromere protein A | 9544 | | Inparanoid, OMA |
Mouse | 12615 | Cenpa | centromere protein A | 10090 | MGI:88375 | Inparanoid, OMA, EggNOG |
Rat | 298850 | Cenpa | centromere protein A | 10116 | RGD:1563607 | Inparanoid, OMA, EggNOG |
Dog | 475692 | CENPA | centromere protein A | 9615 | VGNC:39101 | Inparanoid, OMA, EggNOG |
Horse | 100055617 | CENPA | centromere protein A | 9796 | VGNC:16392 | Inparanoid, OMA, EggNOG |
Cow | 782601 | LOC782601 | histone H3-like centromeric protein A | 9913 | | OMA, EggNOG |
Opossum | 100030899 | CENPA | centromere protein A | 13616 | | Inparanoid, EggNOG |
Anole lizard | 100552579 | LOC100552579 | histone H3-like centromeric protein A | 28377 | | OMA, EggNOG |
Xenopus | 549339 | cenpa | centromere protein A | 8364 | XB-GENE-484234 | Inparanoid, EggNOG |
Associated Recombinant Proteins
Associated Antibodies
Name | Specifications | Species reactivity | Application | Availability | View Details |
---|
Associated Approved Drugs
Associated Active Ligands