The store will not work correctly when cookies are disabled.
Protein or Target Summary
Histone H3-like centromeric protein A
| Gene ID | 1058 |
|---|
| uniprot | P49450 |
|---|
| Gene Name | CENPA |
|---|
| Ensernbl ID | ENSP00000336868 |
|---|
| Family | Belongs to the histone H3 family. |
|---|
| Sequence | MGPRRRSRKPEAPRRRSPSPTPTPGPSRRGPSLGASSHQHSRRRQGWLKEIRKLQKSTHLLIRKLPFSRLAREICVKFTRGVDFNWQAQALLALQEAAEAFLVHLFEDAYLLTLHAGRVTLFPKDVQLARRIRGLEEGLG Show more |
|---|
Gene and Protein Information
| Species | Gene ID | Gene Symbol | Gene Name | Uniprot |
|---|
| HUMAN | 1058 | CENPA | Histone H3-like centromeric protein A | P49450 |
| MOUSE | 12615 | Cenpa | Histone H3-like centromeric protein A | O35216 |
| MOUSE | | Cenpa | Histone H3-like centromeric protein A | A0A0G2JGI2 |
| MOUSE | | Cenpa | Histone H3-like centromeric protein A | A0A0G2JEV0 |
| MOUSE | | Cenpa | Centromere protein A, isoform CRA_a | D6RJ71 |
| MOUSE | | Cenpa | Centromere protein A, isoform CRA_f | A0A0G2JEV2 |
| MOUSE | | Cenpa | Centromere protein A, isoform CRA_c | D6RCV6 |
| RAT | 298850 | Cenpa | Centromere protein A | B2RZ23 |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
