JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

྾

Home
Targets(Human)
CENPA

CENPA

Description	Histone H3-like centromeric protein A

Gene and Protein Information

Gene ID	1058
Uniprot Accession IDs	D6W544 Q53T74 Q9BVW2
Ensembl ID	ENSP00000336868
Symbol	CenH3 CENP-A
Family	Belongs to the histone H3 family.
Sequence	MGPRRRSRKPEAPRRRSPSPTPTPGPSRRGPSLGASSHQHSRRRQGWLKEIRKLQKSTHLLIRKLPFSRLAREICVKFTRGVDFNWQAQALLALQEAAEAFLVHLFEDAYLLTLHAGRVTLFPKDVQLARRIRGLEEGLG

Homologous gene and protein info.

Species	Gene ID	Gene Symbol	Name	Tax ID	Other Gene ID	Sources
Chimp	459086	CENPA	centromere protein A	9598	VGNC:191	OMA, EggNOG
Macaque	697312	CENPA	centromere protein A	9544		Inparanoid, OMA
Mouse	12615	Cenpa	centromere protein A	10090	MGI:88375	Inparanoid, OMA, EggNOG
Rat	298850	Cenpa	centromere protein A	10116	RGD:1563607	Inparanoid, OMA, EggNOG
Dog	475692	CENPA	centromere protein A	9615	VGNC:39101	Inparanoid, OMA, EggNOG
Horse	100055617	CENPA	centromere protein A	9796	VGNC:16392	Inparanoid, OMA, EggNOG
Cow	782601	LOC782601	histone H3-like centromeric protein A	9913		OMA, EggNOG
Opossum	100030899	CENPA	centromere protein A	13616		Inparanoid, EggNOG
Anole lizard	100552579	LOC100552579	histone H3-like centromeric protein A	28377		OMA, EggNOG
Xenopus	549339	cenpa	centromere protein A	8364	XB-GENE-484234	Inparanoid, EggNOG

Associated Recombinant Proteins

Name	Specification and purity	Expression system	Protein label	Activity	View Details

Associated Antibodies

Name	Specifications	Species reactivity	species	Application	View Details

Associated Approved Drugs

Associated Active Ligands

Associated Diseases

Name	Disease Type	Mondoid

Pathway

Data Source	Name	Explore more targets	Explore in Source

🔙[Back to Target (Human)]