Protein or Target Summary
Receptor expression-enhancing protein 2
| Gene ID | 51308 |
|---|---|
| uniprot | Q9BRK0 |
| Gene Name | REEP2 |
| Ensernbl ID | ENSP00000367590 |
| Family | Belongs to the DP1 family. |
| Sequence | MVSWIISRLVVLIFGTLYPAYSSYKAVKTKNVKEYVKWMMYWIVFAFFTTAETLTDIVLSWFPFYFELKIAFVIWLLSPYTKGSSVLYRKFVHPTLSNKEKEIDEYITQARDKSYETMMRVGKRGLNLAANAAVTAAAKGVLSEKLRSFSMQDLTLIRDEDALPLQRPDGRLRPSPGSLLDTIEDLGDDPALSLRSSTNPADSRTEASEDDMGDKAPKRAKPIKKAPKAEPLASKTLKTRPKKKTSGGGDSA Show more |
Gene and Protein Information
| Species | Gene ID | Gene Symbol | Gene Name | Uniprot |
|---|---|---|---|---|
| HUMAN | 51308 | REEP2 | Receptor expression-enhancing protein 2 | Q9BRK0 |
| MOUSE | 225362 | Reep2 | Receptor expression-enhancing protein | C1IE02 |
| MOUSE | Reep2 | Uncharacterized protein | Q3TYE9 | |
| MOUSE | 225362 | Reep2 | Receptor expression-enhancing protein 2 | Q8VCD6 |
| RAT | 682105 | Reep2 | Receptor expression-enhancing protein | Q0VGJ9 |
| RAT | Reep2 | Receptor expression-enhancing protein | A0A0G2K1L5 | |
| RAT | Reep2 | Receptor expression-enhancing protein | M0R8C1 |
Protein Classes
PANTHER Classes
protein / transporter / Receptor expression-enhancing protein 2
protein / receptor / Receptor expression-enhancing protein 2
protein / transporter / Receptor expression-enhancing protein 2
protein / receptor / Receptor expression-enhancing protein 2
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Disease Type | Mondoid |
|---|
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
Source: DataSourcesLicenses.xlsx