Protein or Target Summary

RING-box protein 2

Gene ID	9616
uniprot	Q9UBF6
Gene Name	RNF7
Ensernbl ID	ENSP00000273480
Family	Belongs to the RING-box family.
Sequence	MADVEDGEETCALASHSGSSGSKSGGDKMFSLKKWNAVAMWSWDVECDTCAICRVQVMDACLRCQAENKQEDCVVVWGECNHSFHNCCMSLWVKQNNRCPLCQQDWVVQRIGK Show more

Gene and Protein Information

Species	Gene ID	Gene Symbol	Gene Name	Uniprot
HUMAN	9616	RNF7	RING-box protein 2	Q9UBF6
MOUSE	19823	Rnf7	RING-box protein 2	Q9WTZ1
MOUSE	19823	Rnf7	RING-box protein 2	D3Z392
RAT	300948	Rnf7	Ring finger protein 7	D3Z8P1

PANTHER Classes
protein / ligase / ubiquitin-protein ligase / RING-box protein 2

DTO Classes
protein / Enzyme / Ligase / Ubiquitin-protein ligase / RING-box protein 2

Name	Specification and purity	Expression system	Protein label	Activity	View Details

Name	Specifications	Species reactivity	species	Application	View Details

Name	Disease Type	Mondoid

Data Source	Name	Explore more targets	Explore in Source