My Cart
You have no items in your shopping cart.
| Description | Retinoic acid receptor gamma |
|---|
Gene and Protein Information
| Gene ID | 5916 |
|---|---|
| Uniprot Accession IDs | P13631 B7Z492 B7Z4F1 B7ZAE4 J3KNP6 P22932 Q15281 Q52LZ8 Q9BYX8 Q9H1I3 Q9UJ38 RAR-gamma |
| Ensembl ID | ENSP00000388510 |
| Symbol | NR1B3 RARC NR1B3 |
| Family | Belongs to the nuclear hormone receptor family. NR1 subfamily. |
| Sequence | MATNKERLFAAGALGPGSGYPGAGFPFAFPGALRGSPPFEMLSPSFRGLGQPDLPKEMASLSVETQSTSSEEMVPSSPSPPPPPRVYKPCFVCNDKSSGYHYGVSSCEGCKGFFRRSIQKNMVYTCHRDKNCIINKVTRNRCQYCRLQKCFEVGMSKEAVRNDRNKKKKEVKEEGSPDSYELSPQLEELITKVSKAHQETFPSLCQLGKYTTNSSADHRVQLDLGLWDKFSELATKCIIKIVEFAKRLPGFTGLSIADQITLLKAACLDILMLRICTRYTPEQDTMTFSDGLTLNRTQMHNAGFGPLTDLVFAFAGQLLPLEMDDTETGLLSAICLICGDRMDLEEPEKVDKLQEPLLEALRLYARRRRPSQPYMFPRMLMKITDLRGISTKGAERAITLKMEIPGPMPPLIREMLENPEMFEDDSSQPGPHPNASSEDEVPGGQGKGGLKSPA Show more |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 451935 | RARG | retinoic acid receptor gamma | 9598 | VGNC:8514 | OMA, EggNOG |
| Macaque | 699532 | RARG | retinoic acid receptor gamma | 9544 | Inparanoid, OMA, EggNOG | |
| Mouse | 19411 | Rarg | retinoic acid receptor, gamma | 10090 | MGI:97858 | Inparanoid, OMA, EggNOG |
| Rat | 685072 | Rarg | retinoic acid receptor, gamma | 10116 | RGD:1583230 | Inparanoid, OMA |
| Dog | 486508 | RARG | retinoic acid receptor gamma | 9615 | VGNC:45353 | Inparanoid, OMA |
| Horse | 100062026 | RARG | retinoic acid receptor gamma | 9796 | VGNC:22186 | Inparanoid, OMA |
| Cow | 540425 | RARG | retinoic acid receptor gamma | 9913 | VGNC:33730 | Inparanoid, OMA |
| Pig | 100626982 | RARG | retinoic acid receptor gamma | 9823 | Inparanoid, OMA | |
| Anole lizard | 100555055 | rarg | retinoic acid receptor gamma | 28377 | Inparanoid, OMA | |
| Xenopus | 100485387 | rarg | retinoic acid receptor gamma | 8364 | XB-GENE-484127 | Inparanoid, OMA |
| Zebrafish | 100034753 | rargb | retinoic acid receptor, gamma b | 7955 | ZDB-GENE-070314-1 | Inparanoid, OMA |
Protein Classes
PANTHER Classes
protein / transcription factor / Retinoic acid receptor gamma
protein / receptor / Retinoic acid receptor gamma
protein / nucleic acid binding / Retinoic acid receptor gamma
protein / C4 zinc finger nuclear receptor / Retinoic acid receptor gamma
protein / transcription factor / Retinoic acid receptor gamma
protein / receptor / Retinoic acid receptor gamma
protein / nucleic acid binding / Retinoic acid receptor gamma
protein / C4 zinc finger nuclear receptor / Retinoic acid receptor gamma
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Availability | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | Application | Availability | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
Bibliography
| 1.Nagpal, S S and 6 more authors. 1999-08-06 Retinoid-dependent recruitment of a histone H1 displacement activity by retinoic acid receptor. [PMID:10428834] |
| 2.Boudjelal, Mohamed M, Voorhees, John J JJ and Fisher, Gary J GJ. 2002-03-10 Retinoid signaling is attenuated by proteasome-mediated degradation of retinoid receptors in human keratinocyte HaCaT cells. [PMID:11855864] |
| 3.Pettersson, F F, Dalgleish, A G AG, Bissonnette, R P RP and Colston, K W KW. 2002-08-27 Retinoids cause apoptosis in pancreatic cancer cells via activation of RAR-gamma and altered expression of Bcl-2/Bax. [PMID:12189556] |
| 4.Klaholz, Bruno B and Moras, Dino D. 2002-09 C-H...O hydrogen bonds in the nuclear receptor RARgamma--a potential tool for drug selectivity. [PMID:12220491] |
| 5.Richter, Frank F and 7 more authors.Immunohistochemical localization of the retinoic Acid receptors in human prostate. [PMID:12399530] |
| 6.Strausberg, Robert L RL and 83 more authors. 2002-12-24 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences. [PMID:12477932] |
| 7.Hauksdottir, Herborg H, Farboud, Behnom B and Privalsky, Martin L ML. 2003-03 Retinoic acid receptors beta and gamma do not repress, but instead activate target gene transcription in both the absence and presence of hormone ligand. [PMID:12554770] |
| 8.Farboud, Behnom B, Hauksdottir, Herborg H, Wu, Yun Y and Privalsky, Martin L ML. 2003-04 Isotype-restricted corepressor recruitment: a constitutively closed helix 12 conformation in retinoic acid receptors beta and gamma interferes with corepressor recruitment and prevents transcriptional repression. [PMID:12665583] |
| 9.Leid, M M and 9 more authors. 1992-01-24 Purification, cloning, and RXR identity of the HeLa cell factor with which RAR or TR heterodimerizes to bind target sequences efficiently. [PMID:1310259] |
| 10.Vollberg, T M TM and 5 more authors. 1992-05 Retinoic acid receptors as regulators of human epidermal keratinocyte differentiation. [PMID:1318502] |