RARG
Description | Retinoic acid receptor gamma |
---|
Gene and Protein Information
Gene ID | 5916 |
---|---|
Uniprot Accession IDs | B7Z492 B7Z4F1 B7ZAE4 J3KNP6 P22932 Q15281 Q52LZ8 Q9BYX8 Q9H1I3 Q9UJ38 RAR-gamma |
Ensembl ID | ENSP00000388510 |
Symbol | NR1B3 RARC NR1B3 |
Family | Belongs to the nuclear hormone receptor family. NR1 subfamily. |
Sequence | MATNKERLFAAGALGPGSGYPGAGFPFAFPGALRGSPPFEMLSPSFRGLGQPDLPKEMASLSVETQSTSSEEMVPSSPSPPPPPRVYKPCFVCNDKSSGYHYGVSSCEGCKGFFRRSIQKNMVYTCHRDKNCIINKVTRNRCQYCRLQKCFEVGMSKEAVRNDRNKKKKEVKEEGSPDSYELSPQLEELITKVSKAHQETFPSLCQLGKYTTNSSADHRVQLDLGLWDKFSELATKCIIKIVEFAKRLPGFTGLSIADQITLLKAACLDILMLRICTRYTPEQDTMTFSDGLTLNRTQMHNAGFGPLTDLVFAFAGQLLPLEMDDTETGLLSAICLICGDRMDLEEPEKVDKLQEPLLEALRLYARRRRPSQPYMFPRMLMKITDLRGISTKGAERAITLKMEIPGPMPPLIREMLENPEMFEDDSSQPGPHPNASSEDEVPGGQGKGGLKSPA Show more |
Homologous gene and protein info.
Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
---|---|---|---|---|---|---|
Chimp | 451935 | RARG | retinoic acid receptor gamma | 9598 | VGNC:8514 | OMA, EggNOG |
Macaque | 699532 | RARG | retinoic acid receptor gamma | 9544 | Inparanoid, OMA, EggNOG | |
Mouse | 19411 | Rarg | retinoic acid receptor, gamma | 10090 | MGI:97858 | Inparanoid, OMA, EggNOG |
Rat | 685072 | Rarg | retinoic acid receptor, gamma | 10116 | RGD:1583230 | Inparanoid, OMA |
Dog | 486508 | RARG | retinoic acid receptor gamma | 9615 | VGNC:45353 | Inparanoid, OMA |
Horse | 100062026 | RARG | retinoic acid receptor gamma | 9796 | VGNC:22186 | Inparanoid, OMA |
Cow | 540425 | RARG | retinoic acid receptor gamma | 9913 | VGNC:33730 | Inparanoid, OMA |
Pig | 100626982 | RARG | retinoic acid receptor gamma | 9823 | Inparanoid, OMA | |
Anole lizard | 100555055 | rarg | retinoic acid receptor gamma | 28377 | Inparanoid, OMA | |
Xenopus | 100485387 | rarg | retinoic acid receptor gamma | 8364 | XB-GENE-484127 | Inparanoid, OMA |
Zebrafish | 100034753 | rargb | retinoic acid receptor, gamma b | 7955 | ZDB-GENE-070314-1 | Inparanoid, OMA |
Protein Classes
PANTHER Classes
protein / transcription factor / Retinoic acid receptor gamma
protein / receptor / Retinoic acid receptor gamma
protein / nucleic acid binding / Retinoic acid receptor gamma
protein / C4 zinc finger nuclear receptor / Retinoic acid receptor gamma
protein / transcription factor / Retinoic acid receptor gamma
protein / receptor / Retinoic acid receptor gamma
protein / nucleic acid binding / Retinoic acid receptor gamma
protein / C4 zinc finger nuclear receptor / Retinoic acid receptor gamma
Associated Recombinant Proteins
Name | Specification and purity | Expression system | Protein label | Activity | View Details |
---|
Associated Antibodies
Name | Specifications | Species reactivity | species | Application | View Details |
---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
Name | Disease Type | Mondoid |
---|
Pathway
Data Source | Name | Explore more targets | Explore in Source |
---|