The store will not work correctly when cookies are disabled.
PRAP1
| Description | Proline-rich acidic protein 1 |
|---|
Gene and Protein Information
| Gene ID | 118471 |
|---|
| Uniprot Accession IDs | B7ZL57 B7ZL58 E9KL31 Q5VWY4 Q7Z4X5 Q8IWR3 Q8NCS2 |
|---|
| Ensembl ID | ENSP00000416126 |
|---|
| Symbol | UPA UPA PRO1195 |
|---|
| Sequence | MRRLLLVTSLVVVLLWEAGAVPAPKVPIKMQVKHWPSEQDPEKAWGARVVEPPEKDDQLVVLFPVQKPKLLTTEEKPRGQGRGPILPGTKAWMETEDTLGHVLSPEPDHDSLYHPPPEEDQGEERPRLWVMPNHQVLLGPEEDQDHIYHPQ |
|---|
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|
| Mouse | 22264 | Prap1 | proline-rich acidic protein 1 | 10090 | MGI:893573 | Inparanoid, EggNOG |
| Rat | 60574 | Prap1 | proline-rich acidic protein 1 | 10116 | RGD:61876 | Inparanoid, EggNOG |
| Dog | 608254 | PRAP1 | proline rich acidic protein 1 | 9615 | VGNC:53010 | Inparanoid, EggNOG |
| Cow | 512786 | PRAP1 | proline rich acidic protein 1 | 9913 | | Inparanoid, EggNOG |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
