The store will not work correctly when cookies are disabled.
Protein or Target Summary
Proline-rich acidic protein 1
| Gene ID | 118471 |
|---|
| uniprot | Q96NZ9 |
|---|
| Gene Name | PRAP1 |
|---|
| Ensernbl ID | ENSP00000416126 |
|---|
| Sequence | MRRLLLVTSLVVVLLWEAGAVPAPKVPIKMQVKHWPSEQDPEKAWGARVVEPPEKDDQLVVLFPVQKPKLLTTEEKPRGQGRGPILPGTKAWMETEDTLGHVLSPEPDHDSLYHPPPEEDQGEERPRLWVMPNHQVLLGPEEDQDHIYHPQ Show more |
|---|
Gene and Protein Information
| Species | Gene ID | Gene Symbol | Gene Name | Uniprot |
|---|
| HUMAN | 118471 | PRAP1 | Proline-rich acidic protein 1 | Q96NZ9 |
| MOUSE | 22264 | Prap1 | Proline-rich acidic protein 1 | Q80XD8 |
| RAT | 60574 | Prap1 | Proline-rich acidic protein 1 | Q9ES75 |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
