JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

Click Here for 5% Off Your First Aladdin Purchase!

྾

Protein or Target Summary

Prolactin-releasing peptide receptor

Gene ID	2834
uniprot	P49683
Gene Name	PRLHR
Ensernbl ID	ENSP00000239032
Family	Belongs to the G-protein coupled receptor 1 family.
Sequence	MASSTTRGPRVSDLFSGLPPAVTTPANQSAEASAGNGSVAGADAPAVTPFQSLQLVHQLKGLIVLLYSVVVVVGLVGNCLLVLVIARVRRLHNVTNFLIGNLALSDVLMCTACVPLTLAYAFEPRGWVFGGGLCHLVFFLQPVTVYVSVFTLTTIAVDRYVVLVHPLRRRISLRLSAYAVLAIWALSAVLALPAAVHTYHVELKPHDVRLCEEFWGSQERQRQLYAWGLLLVTYLLPLLVILLSYVRVSVKLRNRVVPGCVTQSQADWDRARRRRTFCLLVVIVVVFAVCWLPLHVFNLLRDLDPHAIDPYAFGLVQLLCHWLAMSSACYNPFIYAWLHDSFREELRKLLVAWPRKIAPHGQNMTVSVVI Show more

Gene and Protein Information

Species	Gene ID	Gene Symbol	Gene Name	Uniprot
HUMAN	2834	PRLHR	Prolactin-releasing peptide receptor	P49683
MOUSE	226278	Prlhr	Prolactin-releasing peptide receptor	Q6VMN6
RAT	246075	Prlhr	Prolactin-releasing peptide receptor	Q64121
RAT		Prlhr	Prolactin releasing hormone receptor	G3V791

Protein Classes

DTO Classes
protein / G-protein coupled receptor / Class A rhodopsin like / Prolactin-releasing peptide receptor

Associated Recombinant Proteins

Name	Specification and purity	Expression system	Protein label	Activity	View Details

Associated Antibodies

Name	Specifications	Species reactivity	species	Application	View Details

Associated Approved Drugs

Associated Active Ligands

Associated Diseases

Name	Disease Type	Mondoid

Pathway

Data Source	Name	Explore more targets	Explore in Source

Source: DataSourcesLicenses.xlsx