Click Here for 5% Off Your First Aladdin Purchase!
Call +1 (833) 552-7181 or Contact us Earn $25 in coupons on your first order with Aladdin!
Toggle Nav
My Cart
Search
Advanced Search
Menu
Sign In
྾

Protein or Target Summary

Proteasome subunit beta type-9

Gene ID5698
uniprotP28065
Gene NamePSMB9
Ensernbl IDENSP00000363993
FamilyBelongs to the peptidase T1B family.
Sequence
MLRAGAPTGDLPRAGEVHTGTTIMAVEFDGGVVMGSDSRVSAGEAVVNRVFDKLSPLHERIYCALSGSAADAQAVADMAAYQLELHGIELEEPPLVLAAANVVRNISYKYREDLSAHLMVAGWDQREGGQVYGTLGGMLTRQPFAIGGSGSTFIYGYVDAAYKPGMSPEECRRFTTDAIALAMSRDGSSGGVIYLVTITAAGVDHRVILGNELPKFYDE
Show more

Gene and Protein Information

SpeciesGene IDGene SymbolGene NameUniprot
HUMAN5698PSMB9Proteasome subunit beta type-9P28065
MOUSE16912Psmb9Proteasome subunit beta type-9P28076
MOUSEPsmb9Proteasome subunit beta type-9F6QXK7
MOUSEPsmb9Proteasome subunit beta type-9G3UYK5
MOUSEPsmb9Proteasome subunit betaQ3U7A7
MOUSEPsmb9Proteasome subunit betaQ3TAR7
MOUSE16912Psmb9Proteasome subunit betaA0A0R4J256
MOUSEPsmb9Proteasome subunit betaQ4FK25
RAT24967Psmb9Proteasome subunit beta type-9P28077
RATPsmb9Proteasome subunit betaA0A023ILN9
RAT24967Psmb9Proteasome subunit betaQ6MGA6

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelActivityView Details

Associated Antibodies

NameSpecificationsSpecies reactivityspeciesApplicationView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDisease TypeMondoid

      Pathway

      Data SourceNameExplore more targetsExplore in Source
      Source: TCRDv6_DataSourcesLicenses.xlsx
      Privacy Policy Website Terms of Use Return policy Terms and Conditions of Sale Cookie Policy Sales Policy
      Products are chemical reagents for research use only and are not intended for human use. We do not sell to patients.
      Copyright © 2023-present Aladdin Scientific Corp . All rights reserved.