The store will not work correctly when cookies are disabled.
Protein or Target Summary
Prostaglandin E synthase
| Gene ID | 9536 |
|---|
| uniprot | O14684 |
|---|
| Gene Name | PTGES |
|---|
| Ensernbl ID | ENSP00000342385 |
|---|
| Family | Belongs to the MAPEG family. |
|---|
| Sequence | MPAHSLVMSSPALPAFLLCSTLLVIKMYVVAIITGQVRLRKKAFANPEDALRHGGPQYCRSDPDVERCLRAHRNDMETIYPFLFLGFVYSFLGPNPFVAWMHFLVFLVGRVAHTVAYLGKLRAPIRSVTYTLAQLPCASMALQILWEAARHL Show more |
|---|
Gene and Protein Information
| Species | Gene ID | Gene Symbol | Gene Name | Uniprot |
|---|
| HUMAN | 9536 | PTGES | Prostaglandin E synthase | O14684 |
| MOUSE | 64292 | Ptges | Prostaglandin E synthase | Q9JM51 |
| MOUSE | 64292 | Ptges | Uncharacterized protein | Q8BNP8 |
| MOUSE | | Ptges | Uncharacterized protein | Q3UDM3 |
| RAT | | Ptges | Ptges protein | Q5I0P8 |
| RAT | 59103 | Ptges | Inducible prostaglandin E synthase | Q9JHF3 |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
