The store will not work correctly when cookies are disabled.
PTH
| Description | Parathyroid hormone |
|---|
Gene and Protein Information
| Gene ID | 5741 |
|---|
| Uniprot Accession IDs | Q4VB48 Q9UD38 PTH |
|---|
| Ensembl ID | ENSP00000282091 |
|---|
| Symbol | PTH1 |
|---|
| Family | Belongs to the parathyroid hormone family. |
|---|
| Sequence | MIPAKDMAKVMIVMLAICFLTKSDGKSVKKRSVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNFVALGAPLAPRDAGSQRPRKKEDNVLVESHEKSLGEADKADVNVLTKAKSQ |
|---|
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|
| Chimp | 466447 | PTH | parathyroid hormone | 9598 | VGNC:1035 | OMA, EggNOG |
| Mouse | 19226 | Pth | parathyroid hormone | 10090 | MGI:97799 | Inparanoid, OMA, EggNOG |
| Rat | 24694 | Pth | parathyroid hormone | 10116 | RGD:3440 | Inparanoid, OMA, EggNOG |
| Dog | 403986 | PTH | parathyroid hormone | 9615 | VGNC:45153 | Inparanoid, OMA, EggNOG |
| Horse | 100034104 | PTH | parathyroid hormone | 9796 | VGNC:21998 | Inparanoid, OMA, EggNOG |
| Cow | 280903 | PTH | parathyroid hormone | 9913 | VGNC:33513 | Inparanoid, OMA, EggNOG |
| Pig | 399502 | PTH | parathyroid hormone | 9823 | | Inparanoid, OMA, EggNOG |
| Opossum | 100030272 | PTH | parathyroid hormone | 13616 | | Inparanoid, OMA, EggNOG |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
