The store will not work correctly when cookies are disabled.
PTH
| Description | Parathyroid hormone |
|---|
Gene and Protein Information
| Gene ID | 5741 |
|---|
| Uniprot Accession IDs | Q4VB48 Q9UD38 PTH |
|---|
| Ensembl ID | ENSP00000282091 |
|---|
| Symbol | PTH1 |
|---|
| Family | Belongs to the parathyroid hormone family. |
|---|
| Sequence | MIPAKDMAKVMIVMLAICFLTKSDGKSVKKRSVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNFVALGAPLAPRDAGSQRPRKKEDNVLVESHEKSLGEADKADVNVLTKAKSQ |
|---|
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
