Protein or Target Summary
Cytochrome b-c1 complex subunit 6, mitochondrial
| Gene ID | 7388 |
|---|---|
| uniprot | P07919 |
| Gene Name | UQCRH |
| Ensernbl ID | ENSP00000309565 |
| Family | Belongs to the UQCRH/QCR6 family. |
| Sequence | MGLEDEQKMLTESGDPEEEEEEEEELVDPLTTVREQCEQLEKCVKARERLELCDERVSSRSHTEEDCTEELFDFLHARDHCVAHKLFNNLK Show more |
Gene and Protein Information
| Species | Gene ID | Gene Symbol | Gene Name | Uniprot |
|---|---|---|---|---|
| HUMAN | 7388 | UQCRH | Cytochrome b-c1 complex subunit 6, mitochondrial | P07919 |
| MOUSE | 66576 | Uqcrh | Cytochrome b-c1 complex subunit 6, mitochondrial | P99028 |
| MOUSE | Uqcrh | Uncharacterized protein | Q8BMU6 | |
| MOUSE | Uqcrh | Cytochrome b-c1 complex subunit 6, mitochondrial | Q9D2Q7 | |
| RAT | 366448 | Uqcrh | Cytochrome b-c1 complex subunit 6, mitochondrial | Q5M9I5 |
Protein Classes
PANTHER Classes
protein / oxidoreductase / reductase / Cytochrome b-c1 complex subunit 6, mitochondrial
protein / oxidoreductase / reductase / Cytochrome b-c1 complex subunit 6, mitochondrial
DTO Classes
protein / Enzyme / Oxidoreductase / Reductase / Cytochrome b-c1 complex subunit 6, mitochondrial
protein / Enzyme / Oxidoreductase / Reductase / Cytochrome b-c1 complex subunit 6, mitochondrial
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Disease Type | Mondoid |
|---|
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
Source: DataSourcesLicenses.xlsx