The store will not work correctly when cookies are disabled.
QPCT
Description | Glutaminyl-peptide cyclotransferase |
---|
Gene and Protein Information
Gene ID | 25797 |
Uniprot Accession IDs | Q16770 Q3KRG6 Q53TR4 |
Ensembl ID | ENSP00000344829 |
Symbol | QC GCT sQC |
Family | Belongs to the glutaminyl-peptide cyclotransferase family. |
Sequence | MAGGRHRRVVGTLHLLLLVAALPWASRGVSPSASAWPEEKNYHQPAILNSSALRQIAEGTSISEMWQNDLQPLLIERYPGSPGSYAARQHIMQRIQRLQADWVLEIDTFLSQTPYGYRSFSNIISTLNPTAKRHLVLACHYDSKYFSHWNNRVFVGATDSAVPCAMMLELARALDKKLLSLKTVSDSKPDLSLQLIFFDGEEAFLHWSPQDSLYGSRHLAAKMASTPHPPGARGTSQLHGMDLLVLLDLIGAPNPTFPNFFPNSARWFERLQAIEHELHELGLLKDHSLEGRYFQNYSYGGVIQDDHIPFLRRGVPVLHLIPSPFPEVWHTMDDNEENLDESTIDNLNKILQVFVLEYLHL Show more |
---|
Homologous gene and protein info.
Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
Chimp | 744549 | QPCT | glutaminyl-peptide cyclotransferase | 9598 | VGNC:377 | OMA, EggNOG |
Macaque | 712233 | QPCT | glutaminyl-peptide cyclotransferase | 9544 | | Inparanoid, OMA, EggNOG |
Mouse | 70536 | Qpct | glutaminyl-peptide cyclotransferase (glutaminyl cyclase) | 10090 | MGI:1917786 | Inparanoid, OMA, EggNOG |
Dog | 403861 | QPCT | glutaminyl-peptide cyclotransferase | 9615 | VGNC:45233 | Inparanoid, OMA, EggNOG |
Horse | 100070174 | QPCT | glutaminyl-peptide cyclotransferase | 9796 | VGNC:22071 | Inparanoid, OMA, EggNOG |
Cow | 281437 | QPCT | glutaminyl-peptide cyclotransferase | 9913 | VGNC:33598 | Inparanoid, OMA, EggNOG |
Pig | 397424 | QPCT | glutaminyl-peptide cyclotransferase | 9823 | | Inparanoid, OMA, EggNOG |
Opossum | 100012208 | QPCT | glutaminyl-peptide cyclotransferase | 13616 | | Inparanoid, EggNOG |
Platypus | 100077983 | QPCT | glutaminyl-peptide cyclotransferase | 9258 | | Inparanoid, OMA, EggNOG |
Anole lizard | 100563262 | qpct | glutaminyl-peptide cyclotransferase | 28377 | | Inparanoid, OMA, EggNOG |
Xenopus | 549999 | qpct | glutaminyl-peptide cyclotransferase | 8364 | XB-GENE-953343 | Inparanoid, OMA, EggNOG |
Zebrafish | 795685 | qpct | glutaminyl-peptide cyclotransferase | 7955 | ZDB-GENE-130827-1 | OMA, EggNOG |
Protein Classes
PANTHER Classes protein /
transferase / Glutaminyl-peptide cyclotransferase
protein /
metalloprotease / Glutaminyl-peptide cyclotransferase
Associated Recombinant Proteins
Name | Specification and purity | Expression system | Protein label | Activity | View Details |
---|
Associated Antibodies
Name | Specifications | Species reactivity | species | Application | View Details |
---|
Associated Approved Drugs
Associated Active Ligands
Pathway
Data Source | Name | Explore more targets | Explore in Source |
---|