Protein or Target Summary

Glutaminyl-peptide cyclotransferase

Gene ID	25797
uniprot	Q16769
Gene Name	QPCT
Ensernbl ID	ENSP00000344829
Family	Belongs to the glutaminyl-peptide cyclotransferase family.
Sequence	MAGGRHRRVVGTLHLLLLVAALPWASRGVSPSASAWPEEKNYHQPAILNSSALRQIAEGTSISEMWQNDLQPLLIERYPGSPGSYAARQHIMQRIQRLQADWVLEIDTFLSQTPYGYRSFSNIISTLNPTAKRHLVLACHYDSKYFSHWNNRVFVGATDSAVPCAMMLELARALDKKLLSLKTVSDSKPDLSLQLIFFDGEEAFLHWSPQDSLYGSRHLAAKMASTPHPPGARGTSQLHGMDLLVLLDLIGAPNPTFPNFFPNSARWFERLQAIEHELHELGLLKDHSLEGRYFQNYSYGGVIQDDHIPFLRRGVPVLHLIPSPFPEVWHTMDDNEENLDESTIDNLNKILQVFVLEYLHL Show more

Gene and Protein Information

Species	Gene ID	Gene Symbol	Gene Name	Uniprot
HUMAN	25797	QPCT	Glutaminyl-peptide cyclotransferase	Q16769
MOUSE	70536	Qpct	Glutaminyl-peptide cyclotransferase	Q9CYK2
MOUSE	70536	Qpct	Uncharacterized protein	Q3UFN2
MOUSE		Qpct	Glutaminyl-peptide cyclotransferase	A0A3B2W7G1
MOUSE	70536	Qpct	Glutaminyl-peptide cyclotransferase	A0A0R4J0G6
MOUSE		Qpct	Glutaminyl-peptide cyclotransferase (Glutaminyl cyclase)	B2RX76
RAT	313837	Qpct	Glutaminyl-peptide cyclotransferase	D4AC85
RAT	313837	Qpct	Glutaminyl-peptide cyclotransferase	A0A0G2K497

Protein Classes

PANTHER Classes
protein / transferase / Glutaminyl-peptide cyclotransferase
protein / metalloprotease / Glutaminyl-peptide cyclotransferase

DTO Classes
protein / Enzyme / Protease / Metalloprotease / Glutaminyl-peptide cyclotransferase

Associated Recombinant Proteins

Name	Specification and purity	Expression system	Protein label	Activity	View Details

Associated Antibodies

Name	Specifications	Species reactivity	species	Application	View Details

Associated Approved Drugs

Associated Active Ligands

Associated Diseases

Name	Disease Type	Mondoid

Pathway

Data Source	Name	Explore more targets	Explore in Source

Source: TCRDv6_DataSourcesLicenses.xlsx