Call +1 (833) 552-7181 or Contact us Earn $25 in coupons on your first order with Aladdin!
Toggle Nav
My Cart
Search
Advanced Search
Menu
Sign In
྾

QPCT

DescriptionGlutaminyl-peptide cyclotransferase

Gene and Protein Information

Gene ID25797
Uniprot Accession IDs Q16770 Q3KRG6 Q53TR4
Ensembl ID ENSP00000344829
Symbol QC GCT sQC
FamilyBelongs to the glutaminyl-peptide cyclotransferase family.
Sequence
MAGGRHRRVVGTLHLLLLVAALPWASRGVSPSASAWPEEKNYHQPAILNSSALRQIAEGTSISEMWQNDLQPLLIERYPGSPGSYAARQHIMQRIQRLQADWVLEIDTFLSQTPYGYRSFSNIISTLNPTAKRHLVLACHYDSKYFSHWNNRVFVGATDSAVPCAMMLELARALDKKLLSLKTVSDSKPDLSLQLIFFDGEEAFLHWSPQDSLYGSRHLAAKMASTPHPPGARGTSQLHGMDLLVLLDLIGAPNPTFPNFFPNSARWFERLQAIEHELHELGLLKDHSLEGRYFQNYSYGGVIQDDHIPFLRRGVPVLHLIPSPFPEVWHTMDDNEENLDESTIDNLNKILQVFVLEYLHL
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameTax IDOther Gene IDSources
Chimp744549QPCTglutaminyl-peptide cyclotransferase9598VGNC:377OMA, EggNOG
Macaque712233QPCTglutaminyl-peptide cyclotransferase9544Inparanoid, OMA, EggNOG
Mouse70536Qpctglutaminyl-peptide cyclotransferase (glutaminyl cyclase)10090MGI:1917786Inparanoid, OMA, EggNOG
Dog403861QPCTglutaminyl-peptide cyclotransferase9615VGNC:45233Inparanoid, OMA, EggNOG
Horse100070174QPCTglutaminyl-peptide cyclotransferase9796VGNC:22071Inparanoid, OMA, EggNOG
Cow281437QPCTglutaminyl-peptide cyclotransferase9913VGNC:33598Inparanoid, OMA, EggNOG
Pig397424QPCTglutaminyl-peptide cyclotransferase9823Inparanoid, OMA, EggNOG
Opossum100012208QPCTglutaminyl-peptide cyclotransferase13616Inparanoid, EggNOG
Platypus100077983QPCTglutaminyl-peptide cyclotransferase9258Inparanoid, OMA, EggNOG
Anole lizard100563262qpctglutaminyl-peptide cyclotransferase28377Inparanoid, OMA, EggNOG
Xenopus549999qpctglutaminyl-peptide cyclotransferase8364XB-GENE-953343Inparanoid, OMA, EggNOG
Zebrafish795685qpctglutaminyl-peptide cyclotransferase7955ZDB-GENE-130827-1OMA, EggNOG

Protein Classes

PANTHER Classes
protein    /    transferase    /    Glutaminyl-peptide cyclotransferase
protein    /    metalloprotease    /    Glutaminyl-peptide cyclotransferase
DTO Classes
protein    /    Enzyme    /    Protease    /    Metalloprotease    /    Glutaminyl-peptide cyclotransferase

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelActivityView Details

Associated Antibodies

NameSpecificationsSpecies reactivityspeciesApplicationView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDisease TypeMondoid

      Pathway

      Data SourceNameExplore more targetsExplore in Source
      🔙[Back to Target (Human)]
      Privacy Policy Website Terms of Use Return policy Terms and Conditions of Sale Cookie Policy Sales Policy
      Products are chemical reagents for research use only and are not intended for human use. We do not sell to patients.
      Copyright © 2023-present Aladdin Scientific Corp . All rights reserved.