The store will not work correctly when cookies are disabled.
Protein or Target Summary
Proteasome subunit beta type-2
| Gene ID | 5690 |
|---|
| uniprot | P49721 |
|---|
| Gene Name | PSMB2 |
|---|
| Ensernbl ID | ENSP00000362334 |
|---|
| Family | Belongs to the peptidase T1B family. |
|---|
| Sequence | MEYLIGIQGPDYVLVASDRVAASNIVQMKDDHDKMFKMSEKILLLCVGEAGDTVQFAEYIQKNVQLYKMRNGYELSPTAAANFTRRNLADCLRSRTPYHVNLLLAGYDEHEGPALYYMDYLAALAKAPFAAHGYGAFLTLSILDRYYTPTISRERAVELLRKCLEELQKRFILNLPTFSVRIIDKNGIHDLDNISFPKQGS Show more |
|---|
Gene and Protein Information
| Species | Gene ID | Gene Symbol | Gene Name | Uniprot |
|---|
| HUMAN | 5690 | PSMB2 | Proteasome subunit beta type-2 | P49721 |
| MOUSE | | Psmb2 | Proteasome subunit beta | Q8BJX0 |
| MOUSE | 26445 | Psmb2 | Proteasome subunit beta type-2 | Q9R1P3 |
| RAT | 29675 | Psmb2 | Proteasome subunit beta type-2 | P40307 |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
