The store will not work correctly when cookies are disabled.
Your company account is blocked and you cannot place orders. If you have questions, please contact your company administrator.
HCRTR1
| Description | Orexin receptor type 1 |
|---|
Gene and Protein Information
| Gene ID | 3061 |
|---|
| Uniprot Accession IDs | O43613 A8K3A6 Q9HBV6 Ox-1-R |
|---|
| Ensembl ID | ENSP00000384387 |
|---|
| Symbol | OX1R |
|---|
| Family | Belongs to the G-protein coupled receptor 1 family. |
|---|
| Sequence | MEPSATPGAQMGVPPGSREPSPVPPDYEDEFLRYLWRDYLYPKQYEWVLIAAYVAVFVVALVGNTLVCLAVWRNHHMRTVTNYFIVNLSLADVLVTAICLPASLLVDITESWLFGHALCKVIPYLQAVSVSVAVLTLSFIALDRWYAICHPLLFKSTARRARGSILGIWAVSLAIMVPQAAVMECSSVLPELANRTRLFSVCDERWADDLYPKIYHSCFFIVTYLAPLGLMAMAYFQIFRKLWGRQIPGTTSALVRNWKRPSDQLGDLEQGLSGEPQPRARAFLAEVKQMRARRKTAKMLMVVLLVFALCYLPISVLNVLKRVFGMFRQASDREAVYACFTFSHWLVYANSAANPIIYNFLSGKFREQFKAAFSCCLPGLGPCGSLKAPSPRSSASHKSLSLQSRCSISKISEHVVLTSVTTVLP Show more |
|---|
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|
| Chimp | 469261 | HCRTR1 | hypocretin receptor 1 | 9598 | VGNC:8049 | OMA, EggNOG |
| Macaque | 705914 | HCRTR1 | hypocretin receptor 1 | 9544 | | Inparanoid, OMA, EggNOG |
| Mouse | 230777 | Hcrtr1 | hypocretin (orexin) receptor 1 | 10090 | MGI:2385650 | Inparanoid, OMA, EggNOG |
| Rat | 25593 | Hcrtr1 | hypocretin receptor 1 | 10116 | RGD:2787 | Inparanoid, OMA, EggNOG |
| Dog | 100855896 | HCRTR1 | hypocretin receptor 1 | 9615 | VGNC:41623 | Inparanoid, OMA, EggNOG |
| Horse | 100056164 | HCRTR1 | hypocretin receptor 1 | 9796 | VGNC:18714 | Inparanoid, OMA |
| Cow | 282248 | HCRTR1 | hypocretin receptor 1 | 9913 | VGNC:29781 | Inparanoid, OMA, EggNOG |
| Pig | 387287 | HCRTR1 | hypocretin receptor 1 | 9823 | | OMA, EggNOG |
| Platypus | 100075542 | HCRTR1 | hypocretin receptor 1 | 9258 | | Inparanoid, OMA |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Availability | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | Application | Availability | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
