The store will not work correctly when cookies are disabled.
DDO
| Description | D-aspartate oxidase |
|---|
Gene and Protein Information
| Gene ID | 8528 |
|---|
| Uniprot Accession IDs | A8KAG4 Q5JXM4 Q5JXM5 Q5JXM6 Q8N552 DASOX |
|---|
| Ensembl ID | ENSP00000357920 |
|---|
| Symbol | DASOX DDO-1 DDO-2 |
|---|
| Family | Belongs to the DAMOX/DASOX family. |
|---|
| Sequence | MDTARIAVVGAGVVGLSTAVCISKLVPRCSVTIISDKFTPDTTSDVAAGMLIPHTYPDTPIHTQKQWFRETFNHLFAIANSAEAGDAGVHLVSGWQIFQSTPTEEVPFWADVVLGFRKMTEAELKKFPQYVFGQAFTTLKCECPAYLPWLEKRIKGSGGWTLTRRIEDLWELHPSFDIVVNCSGLGSRQLAGDSKIFPVRGQVLQVQAPWVEHFIRDGSGLTYIYPGTSHVTLGGTRQKGDWNLSPDAENSREILSRCCALEPSLHGACNIREKVGLRPYRPGVRLQTELLARDGQRLPVVHHYGHGSGGISVHWGTALEAARLVSECVHALRTPIPKSNL Show more |
|---|
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|
| Chimp | 100608048 | DDO | D-aspartate oxidase | 9598 | VGNC:2682 | OMA, EggNOG |
| Mouse | 70503 | Ddo | D-aspartate oxidase | 10090 | MGI:1925528 | Inparanoid, OMA, EggNOG |
| Rat | 685325 | Ddo | D-aspartate oxidase | 10116 | RGD:1595123 | Inparanoid, OMA, EggNOG |
| Dog | 475026 | DDO | D-aspartate oxidase | 9615 | VGNC:39840 | Inparanoid, OMA, EggNOG |
| Horse | 100072326 | DDO | D-aspartate oxidase | 9796 | VGNC:17079 | Inparanoid, OMA, EggNOG |
| Cow | 280763 | DDO | D-aspartate oxidase | 9913 | VGNC:27951 | Inparanoid, OMA, EggNOG |
| Pig | 100037287 | DDO | D-aspartate oxidase | 9823 | | Inparanoid, OMA, EggNOG |
| Opossum | | DDO | D-aspartate oxidase [Source:HGNC Symbol;Acc:HGNC:2727] | 13616 | | Inparanoid, OMA, EggNOG |
| Platypus | 100092192 | DDO | D-aspartate oxidase | 9258 | | Inparanoid, OMA, EggNOG |
| Chicken | 770953 | DDO | D-aspartate oxidase | 9031 | CGNC:11198 | Inparanoid, OMA, EggNOG |
| Anole lizard | 100558720 | ddo | D-aspartate oxidase | 28377 | | Inparanoid, OMA, EggNOG |
| Xenopus | 100488513 | ddo | D-aspartate oxidase | 8364 | XB-GENE-6258233 | Inparanoid, OMA, EggNOG |
| Zebrafish | 565385 | zgc:172341 | zgc:172341 | 7955 | ZDB-GENE-080204-116 | Inparanoid, OMA |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
