Protein or Target Summary
Group IID secretory phospholipase A2
| Gene ID | 26279 |
|---|---|
| uniprot | Q9UNK4 |
| Gene Name | PLA2G2D |
| Ensernbl ID | ENSP00000364246 |
| Family | Belongs to the phospholipase A2 family. |
| Sequence | MELALLCGLVVMAGVIPIQGGILNLNKMVKQVTGKMPILSYWPYGCHCGLGGRGQPKDATDWCCQTHDCCYDHLKTQGCSIYKDYYRYNFSQGNIHCSDKGSWCEQQLCACDKEVAFCLKRNLDTYQKRLRFYWRPHCRGQTPGC Show more |
Gene and Protein Information
Protein Classes
DTO Classes
protein / Enzyme / Hydrolase / Lipase / Phospholipase / Group IID secretory phospholipase A2
protein / Enzyme / Hydrolase / Lipase / Phospholipase / Group IID secretory phospholipase A2
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Disease Type | Mondoid |
|---|
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
Source: DataSourcesLicenses.xlsx