The store will not work correctly when cookies are disabled.
Protein or Target Summary
Platelet-activating factor acetylhydrolase 2, cytoplasmic
| Gene ID | 5051 |
|---|
| uniprot | Q99487 |
|---|
| Gene Name | PAFAH2 |
|---|
| Ensernbl ID | ENSP00000363400 |
|---|
| Family | Belongs to the serine esterase family. |
|---|
| Sequence | MGVNQSVGFPPVTGPHLVGCGDVMEGQNLQGSFFRLFYPCQKAEETMEQPLWIPRYEYCTGLAEYLQFNKRCGGLLFNLAVGSCRLPVSWNGPFKTKDSGYPLIIFSHGLGAFRTLYSAFCMELASRGFVVAVPEHRDRSAATTYFCKQAPEENQPTNESLQEEWIPFRRVEEGEKEFHVRNPQVHQRVSECLRVLKILQEVTAGQTVFNILPGGLDLMTLKGNIDMSRVAVMGHSFGGATAILALAKETQFRCAVALDAWMFPLERDFYPKARGPVFFINTEKFQTMESVNLMKKICAQHEQSRIITVLGSVHRSQTDFAFVTGNLIGKFFSTETRGSLDPYEGQEVMVRAMLAFLQKHLDLKEDYNQWNNLIEGIGPSLTPGAPHHLSSL Show more |
|---|
Gene and Protein Information
| Species | Gene ID | Gene Symbol | Gene Name | Uniprot |
|---|
| HUMAN | 5051 | PAFAH2 | Platelet-activating factor acetylhydrolase 2, cytoplasmic | Q99487 |
| MOUSE | | Pafah2 | Platelet-activating factor acetylhydrolase 2, cytoplasmic | D3Z3Q4 |
| MOUSE | 100163 | Pafah2 | Platelet-activating factor acetylhydrolase | E9QNW6 |
| MOUSE | | Pafah2 | Platelet-activating factor acetylhydrolase | Q3UNQ4 |
| MOUSE | | Pafah2 | Platelet-activating factor acetylhydrolase | Q3U0K4 |
| MOUSE | 100163 | Pafah2 | Platelet-activating factor acetylhydrolase 2, cytoplasmic | Q8VDG7 |
| RAT | | Pafah2 | Platelet-activating factor acetylhydrolase | A0A0G2JT51 |
| RAT | 313611 | Pafah2 | Platelet-activating factor acetylhydrolase 2, cytoplasmic | P83006 |
Protein Classes
PANTHER Classes protein /
hydrolase /
esterase / Platelet-activating factor acetylhydrolase 2, cytoplasmic
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
