Click Here for 5% Off Your First Aladdin Purchase!

Protein or Target Summary

Cytochrome b-c1 complex subunit 2, mitochondrial

Gene ID7385
uniprotP22695
Gene NameUQCRC2
Ensernbl IDENSP00000268379
FamilyBelongs to the peptidase M16 family. UQCRC2/QCR2 subfamily.
Sequence
MKLLTRAGSFSRFYSLKVAPKVKATAAPAGAPPQPQDLEFTKLPNGLVIASLENYSPVSRIGLFIKAGSRYEDFSNLGTTHLLRLTSSLTTKGASSFKITRGIEAVGGKLSVTATRENMAYTVECLRGDVDILMEFLLNVTTAPEFRRWEVADLQPQLKIDKAVAFQNPQTHVIENLHAAAYRNALANPLYCPDYRIGKVTSEELHYFVQNHFTSARMALIGLGVSHPVLKQVAEQFLNMRGGLGLSGAKANYRGGEIREQNGDSLVHAAFVAESAVAGSAEANAFSVLQHVLGAGPHVKRGSNTTSHLHQAVAKATQQPFDVSAFNASYSDSGLFGIYTISQATAAGDVIKAAYNQVKTIAQGNLSNTDVQAAKNKLKAGYLMSVESSECFLEEVGSQALVAGSYMPPSTVLQQIDSVANADIINAAKKFVSGQKSMAASGNLGHTPFVDEL
Show more

Gene and Protein Information

SpeciesGene IDGene SymbolGene NameUniprot
HUMAN7385UQCRC2Cytochrome b-c1 complex subunit 2, mitochondrialP22695
MOUSE67003Uqcrc2Cytochrome b-c1 complex subunit 2, mitochondrialQ9DB77
MOUSEUqcrc2Cytochrome b-c1 complex subunit 2, mitochondrialA0A140LI98
RAT293448Uqcrc2Cytochrome b-c1 complex subunit 2, mitochondrialP32551

Protein Classes

PANTHER Classes
protein    /    metalloprotease    /    Cytochrome b-c1 complex subunit 2, mitochondrial
protein    /    protease    /    Cytochrome b-c1 complex subunit 2, mitochondrial
protein    /    hydrolase    /    Cytochrome b-c1 complex subunit 2, mitochondrial
DTO Classes
protein    /    Enzyme    /    Protease    /    Metalloprotease    /    Cytochrome b-c1 complex subunit 2, mitochondrial

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelActivityView Details

Associated Antibodies

NameSpecificationsSpecies reactivityspeciesApplicationView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDisease TypeMondoid

      Pathway

      Data SourceNameExplore more targetsExplore in Source