Protein or Target Summary
Cytochrome b-c1 complex subunit 2, mitochondrial
Gene ID | 7385 |
---|---|
uniprot | P22695 |
Gene Name | UQCRC2 |
Ensernbl ID | ENSP00000268379 |
Family | Belongs to the peptidase M16 family. UQCRC2/QCR2 subfamily. |
Sequence | MKLLTRAGSFSRFYSLKVAPKVKATAAPAGAPPQPQDLEFTKLPNGLVIASLENYSPVSRIGLFIKAGSRYEDFSNLGTTHLLRLTSSLTTKGASSFKITRGIEAVGGKLSVTATRENMAYTVECLRGDVDILMEFLLNVTTAPEFRRWEVADLQPQLKIDKAVAFQNPQTHVIENLHAAAYRNALANPLYCPDYRIGKVTSEELHYFVQNHFTSARMALIGLGVSHPVLKQVAEQFLNMRGGLGLSGAKANYRGGEIREQNGDSLVHAAFVAESAVAGSAEANAFSVLQHVLGAGPHVKRGSNTTSHLHQAVAKATQQPFDVSAFNASYSDSGLFGIYTISQATAAGDVIKAAYNQVKTIAQGNLSNTDVQAAKNKLKAGYLMSVESSECFLEEVGSQALVAGSYMPPSTVLQQIDSVANADIINAAKKFVSGQKSMAASGNLGHTPFVDEL Show more |
Gene and Protein Information
Species | Gene ID | Gene Symbol | Gene Name | Uniprot |
---|---|---|---|---|
HUMAN | 7385 | UQCRC2 | Cytochrome b-c1 complex subunit 2, mitochondrial | P22695 |
MOUSE | 67003 | Uqcrc2 | Cytochrome b-c1 complex subunit 2, mitochondrial | Q9DB77 |
MOUSE | Uqcrc2 | Cytochrome b-c1 complex subunit 2, mitochondrial | A0A140LI98 | |
RAT | 293448 | Uqcrc2 | Cytochrome b-c1 complex subunit 2, mitochondrial | P32551 |
Protein Classes
PANTHER Classes
protein / metalloprotease / Cytochrome b-c1 complex subunit 2, mitochondrial
protein / protease / Cytochrome b-c1 complex subunit 2, mitochondrial
protein / hydrolase / Cytochrome b-c1 complex subunit 2, mitochondrial
protein / metalloprotease / Cytochrome b-c1 complex subunit 2, mitochondrial
protein / protease / Cytochrome b-c1 complex subunit 2, mitochondrial
protein / hydrolase / Cytochrome b-c1 complex subunit 2, mitochondrial
DTO Classes
protein / Enzyme / Protease / Metalloprotease / Cytochrome b-c1 complex subunit 2, mitochondrial
protein / Enzyme / Protease / Metalloprotease / Cytochrome b-c1 complex subunit 2, mitochondrial
Associated Recombinant Proteins
Name | Specification and purity | Expression system | Protein label | Activity | View Details |
---|
Associated Antibodies
Name | Specifications | Species reactivity | species | Application | View Details |
---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
Name | Disease Type | Mondoid |
---|
Pathway
Data Source | Name | Explore more targets | Explore in Source |
---|
Source: TCRDv6_DataSourcesLicenses.xlsx