Protein or Target Summary
Beta-Ala-His dipeptidase
| Gene ID | 84735 |
|---|---|
| uniprot | Q96KN2 |
| Gene Name | CNDP1 |
| Ensernbl ID | ENSP00000351682 |
| Family | Belongs to the peptidase M20A family. |
| Sequence | MDPKLGRMAASLLAVLLLLLERGMFSSPSPPPALLEKVFQYIDLHQDEFVQTLKEWVAIESDSVQPVPRFRQELFRMMAVAADTLQRLGARVASVDMGPQQLPDGQSLPIPPIILAELGSDPTKGTVCFYGHLDVQPADRGDGWLTDPYVLTEVDGKLYGRGATDNKGPVLAWINAVSAFRALEQDLPVNIKFIIEGMEEAGSVALEELVEKEKDRFFSGVDYIVISDNLWISQRKPAITYGTRGNSYFMVEVKCRDQDFHSGTFGGILHEPMADLVALLGSLVDSSGHILVPGIYDEVVPLTEEEINTYKAIHLDLEEYRNSSRVEKFLFDTKEEILMHLWRYPSLSIHGIEGAFDEPGTKTVIPGRVIGKFSIRLVPHMNVSAVEKQVTRHLEDVFSKRNSSNKMVVSMTLGLHPWIANIDDTQYLAAKRAIRTVFGTEPDMIRDGSTIPIAKMFQEIVHKSVVLIPLGAVDDGEHSQNEKINRWNYIEGTKLFAAFFLEMAQLH Show more |
Gene and Protein Information
| Species | Gene ID | Gene Symbol | Gene Name | Uniprot |
|---|---|---|---|---|
| HUMAN | 84735 | CNDP1 | Beta-Ala-His dipeptidase | Q96KN2 |
| MOUSE | 338403 | Cndp1 | Beta-Ala-His dipeptidase | Q8BUG2 |
| MOUSE | 338403 | Cndp1 | Beta-Ala-His dipeptidase | A0A0R4J0V0 |
| MOUSE | 338403 | Cndp1 | Uncharacterized protein | Q3TMU4 |
| MOUSE | 338403 | Cndp1 | Uncharacterized protein | Q3TSF8 |
| RAT | 307212 | Cndp1 | Beta-Ala-His dipeptidase | Q66HG3 |
Protein Classes
PANTHER Classes
protein / hydrolase / deacetylase / Beta-Ala-His dipeptidase
protein / hydrolase / metalloprotease / Beta-Ala-His dipeptidase
protein / hydrolase / protease / Beta-Ala-His dipeptidase
protein / hydrolase / deacetylase / Beta-Ala-His dipeptidase
protein / hydrolase / metalloprotease / Beta-Ala-His dipeptidase
protein / hydrolase / protease / Beta-Ala-His dipeptidase
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Disease Type | Mondoid |
|---|
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
Source: DataSourcesLicenses.xlsx