POU5F1

DescriptionPOU domain, class 5, transcription factor 1

Gene and Protein Information

Gene ID5460
Uniprot Accession IDs A6NCS1 A6NLL8 D2IYK4 P31359 Q15167 Q15168 Q16422 Q5STF3 Q5STF4
Ensembl ID ENSP00000259915
Symbol OCT3 OCT4 OTF3 OCT3 OCT4 OTF3 OTF4 OTF-3 Oct-3 Oct-4
FamilyBelongs to the POU transcription factor family. Class-5 subfamily.
Sequence
MAGHLASDFAFSPPPGGGGDGPGGPEPGWVDPRTWLSFQGPPGGPGIGPGVGPGSEVWGIPPCPPPYEFCGGMAYCGPQVGVGLVPQGGLETSQPEGEAGVGVESNSDGASPEPCTVTPGAVKLEKEKLEQNPEESQDIKALQKELEQFAKLLKQKRITLGYTQADVGLTLGVLFGKVFSQTTICRFEALQLSFKNMCKLRPLLQKWVEEADNNENLQEICKAETLVQARKRKRTSIENRVRGNLENLFLQCPKPTLQQISHIAQQLGLEKDVVRVWFCNRRQKGKRSSSDYAQREDFEAAGSPFSGGPVSFPLAPGPHFGTPGYGSPHFTALYSSVPFPEGEAFPPVSVTTLGSPMHSN
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameTax IDOther Gene IDSources
Chimp744263POU5F1POU class 5 homeobox 19598Inparanoid, OMA, EggNOG
Macaque714760POU5F1POU class 5 homeobox 19544Inparanoid, OMA

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelActivityView Details

Associated Antibodies

NameSpecificationsSpecies reactivityspeciesApplicationView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDisease TypeMondoid

      Pathway

      Data SourceNameExplore more targetsExplore in Source