The store will not work correctly when cookies are disabled.
POU5F1
| Description | POU domain, class 5, transcription factor 1 |
|---|
Gene and Protein Information
| Gene ID | 5460 |
|---|
| Uniprot Accession IDs | A6NCS1 A6NLL8 D2IYK4 P31359 Q15167 Q15168 Q16422 Q5STF3 Q5STF4 |
|---|
| Ensembl ID | ENSP00000259915 |
|---|
| Symbol | OCT3 OCT4 OTF3 OCT3 OCT4 OTF3 OTF4 OTF-3 Oct-3 Oct-4 |
|---|
| Family | Belongs to the POU transcription factor family. Class-5 subfamily. |
|---|
| Sequence | MAGHLASDFAFSPPPGGGGDGPGGPEPGWVDPRTWLSFQGPPGGPGIGPGVGPGSEVWGIPPCPPPYEFCGGMAYCGPQVGVGLVPQGGLETSQPEGEAGVGVESNSDGASPEPCTVTPGAVKLEKEKLEQNPEESQDIKALQKELEQFAKLLKQKRITLGYTQADVGLTLGVLFGKVFSQTTICRFEALQLSFKNMCKLRPLLQKWVEEADNNENLQEICKAETLVQARKRKRTSIENRVRGNLENLFLQCPKPTLQQISHIAQQLGLEKDVVRVWFCNRRQKGKRSSSDYAQREDFEAAGSPFSGGPVSFPLAPGPHFGTPGYGSPHFTALYSSVPFPEGEAFPPVSVTTLGSPMHSN Show more |
|---|
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|
| Chimp | 744263 | POU5F1 | POU class 5 homeobox 1 | 9598 | | Inparanoid, OMA, EggNOG |
| Macaque | 714760 | POU5F1 | POU class 5 homeobox 1 | 9544 | | Inparanoid, OMA |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Availability | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | Application | Availability | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
