The store will not work correctly when cookies are disabled.
Protein or Target Summary
POU domain, class 5, transcription factor 1
| Gene ID | 5460 |
|---|
| uniprot | Q01860 |
|---|
| Gene Name | POU5F1 |
|---|
| Ensernbl ID | ENSP00000259915 |
|---|
| Family | Belongs to the POU transcription factor family. Class-5 subfamily. |
|---|
| Sequence | MAGHLASDFAFSPPPGGGGDGPGGPEPGWVDPRTWLSFQGPPGGPGIGPGVGPGSEVWGIPPCPPPYEFCGGMAYCGPQVGVGLVPQGGLETSQPEGEAGVGVESNSDGASPEPCTVTPGAVKLEKEKLEQNPEESQDIKALQKELEQFAKLLKQKRITLGYTQADVGLTLGVLFGKVFSQTTICRFEALQLSFKNMCKLRPLLQKWVEEADNNENLQEICKAETLVQARKRKRTSIENRVRGNLENLFLQCPKPTLQQISHIAQQLGLEKDVVRVWFCNRRQKGKRSSSDYAQREDFEAAGSPFSGGPVSFPLAPGPHFGTPGYGSPHFTALYSSVPFPEGEAFPPVSVTTLGSPMHSN Show more |
|---|
Gene and Protein Information
| Species | Gene ID | Gene Symbol | Gene Name | Uniprot |
|---|
| HUMAN | 5460 | POU5F1 | POU domain, class 5, transcription factor 1 | Q01860 |
| MOUSE | | Pou5f1 | POU domain protein | A0A2I6EDJ6 |
| MOUSE | | Pou5f1 | Octamer-binding transcription factor 3 | E2JL35 |
| MOUSE | 18999 | Pou5f1 | POU domain protein | A0A2I6EDI9 |
| MOUSE | | Pou5f1 | Octamer-binding transcription factor 3 alternative variant | E2JL33 |
| MOUSE | | Pou5f1 | Octamer-binding transcription factor 3 alternative variant | E2JL30 |
| MOUSE | | Pou5f1 | Oct-3/4 protein | G3UZG9 |
| MOUSE | 18999 | Pou5f1 | POU domain, class 5, transcription factor 1 | P20263 |
| RAT | 294562 | Pou5f1 | POU domain protein | Q6MG27 |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
