The store will not work correctly when cookies are disabled.
Protein or Target Summary
Proteasome subunit beta type-10
| Gene ID | 5699 |
|---|
| uniprot | P40306 |
|---|
| Gene Name | PSMB10 |
|---|
| Ensernbl ID | ENSP00000351314 |
|---|
| Family | Belongs to the peptidase T1B family. |
|---|
| Sequence | MLKPALEPRGGFSFENCQRNASLERVLPGLKVPHARKTGTTIAGLVFQDGVILGADTRATNDSVVADKSCEKIHFIAPKIYCCGAGVAADAEMTTRMVASKMELHALSTGREPRVATVTRILRQTLFRYQGHVGASLIVGGVDLTGPQLYGVHPHGSYSRLPFTALGSGQDAALAVLEDRFQPNMTLEAAQGLLVEAVTAGILGDLGSGGNVDACVITKTGAKLLRTLSSPTEPVKRSGRYHFVPGTTAVLTQTVKPLTLELVEETVQAMEVE Show more |
|---|
Gene and Protein Information
| Species | Gene ID | Gene Symbol | Gene Name | Uniprot |
|---|
| HUMAN | 5699 | PSMB10 | Proteasome subunit beta type-10 | P40306 |
| MOUSE | 19171 | Psmb10 | Proteasome subunit beta type-10 | O35955 |
| MOUSE | | Psmb10 | Proteasome subunit beta | Q4FJX8 |
| MOUSE | | Psmb10 | Prosome Mecl1 | Q920I3 |
| MOUSE | | Psmb10 | Proteasome subunit beta | Q3UNP9 |
| RAT | 291983 | Psmb10 | Proteasome subunit beta type-10 | Q4KM35 |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
