The store will not work correctly when cookies are disabled.
Protein or Target Summary
Proteasome subunit beta type-11
| Gene ID | 122706 |
|---|
| uniprot | A5LHX3 |
|---|
| Gene Name | PSMB11 |
|---|
| Ensernbl ID | ENSP00000386212 |
|---|
| Family | Belongs to the peptidase T1B family. |
|---|
| Sequence | MALQDVCKWQSPDTQGPSPHLPRAGGWAVPRGCDPQTFLQIHGPRLAHGTTTLAFRFRHGVIAAADTRSSCGSYVACPASCKVIPVHQHLLGTTSGTSADCATWYRVLQRELRLRELREGQLPSVASAAKLLSAMMSQYRGLDLCVATALCGWDRSGPELFYVYSDGTRLQGDIFSVGSGSPYAYGVLDRGYRYDMSTQEAYALARCAVAHATHRDAYSGGSVDLFHVRESGWEHVSRSDACVLYVELQKLLEPEPEEDASHAHPEPATAHRAAEDRELSVGPGEVTPGDSRMPAGTETV Show more |
|---|
Gene and Protein Information
| Species | Gene ID | Gene Symbol | Gene Name | Uniprot |
|---|
| HUMAN | 122706 | PSMB11 | Proteasome subunit beta type-11 | A5LHX3 |
| MOUSE | 73902 | Psmb11 | Proteasome subunit beta type-11 | Q8BG41 |
| RAT | 290206 | Psmb11 | Proteasome subunit beta | M0R7C4 |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
