The store will not work correctly when cookies are disabled.
Protein or Target Summary
Tyrosine-protein phosphatase non-receptor type 1
| Gene ID | 5770 |
|---|
| uniprot | P18031 |
|---|
| Gene Name | PTPN1 |
|---|
| Ensernbl ID | ENSP00000360683 |
|---|
| Family | Belongs to the protein-tyrosine phosphatase family. Non-receptor class 1 subfamily. |
|---|
| Sequence | MEMEKEFEQIDKSGSWAAIYQDIRHEASDFPCRVAKLPKNKNRNRYRDVSPFDHSRIKLHQEDNDYINASLIKMEEAQRSYILTQGPLPNTCGHFWEMVWEQKSRGVVMLNRVMEKGSLKCAQYWPQKEEKEMIFEDTNLKLTLISEDIKSYYTVRQLELENLTTQETREILHFHYTTWPDFGVPESPASFLNFLFKVRESGSLSPEHGPVVVHCSAGIGRSGTFCLADTCLLLMDKRKDPSSVDIKKVLLEMRKFRMGLIQTADQLRFSYLAVIEGAKFIMGDSSVQDQWKELSHEDLEPPPEHIPPPPRPPKRILEPHNGKCREFFPNHQWVKEETQEDKDCPIKEEKGSPLNAAPYGIESMSQDTEVRSRVVGGSLRGAQAASPAKGEPSLPEKDEDHALSYWKPFLVNMCVATVLTAGAYLCYRFLFNSNT Show more |
|---|
Gene and Protein Information
| Species | Gene ID | Gene Symbol | Gene Name | Uniprot |
|---|
| HUMAN | 5770 | PTPN1 | Tyrosine-protein phosphatase non-receptor type 1 | P18031 |
| MOUSE | 19246 | Ptpn1 | Tyrosine-protein phosphatase non-receptor type 1 | P35821 |
| MOUSE | | Ptpn1 | Tyrosine-protein phosphatase non-receptor type | Q3UCZ5 |
| MOUSE | | Ptpn1 | Uncharacterized protein | Q3T9Y9 |
| MOUSE | | Ptpn1 | Uncharacterized protein | Q3TB93 |
| MOUSE | 19246 | Ptpn1 | Tyrosine-protein phosphatase non-receptor type | Q3TZW9 |
| RAT | 24697 | Ptpn1 | Tyrosine-protein phosphatase non-receptor type 1 | P20417 |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
