Protein or Target Summary

26S proteasome non-ATPase regulatory subunit 14

Gene ID	10213
uniprot	O00487
Gene Name	PSMD14
Ensernbl ID	ENSP00000386541
Family	Belongs to the peptidase M67A family. PSMD14 subfamily.
Sequence	MDRLLRLGGGMPGLGQGPPTDAPAVDTAEQVYISSLALLKMLKHGRAGVPMEVMGLMLGEFVDDYTVRVIDVFAMPQSGTGVSVEAVDPVFQAKMLDMLKQTGRPEMVVGWYHSHPGFGCWLSGVDINTQQSFEALSERAVAVVVDPIQSVKGKVVIDAFRLINANMMVLGHEPRQTTSNLGHLNKPSIQALIHGLNRHYYSITINYRKNELEQKMLLNLHKKSWMEGLTLQDYSEHCKHNESVVKEMLELAKNYNKAVEEEDKMTPEQLAIKNVGKQDPKRHLEEHVDVLMTSNIVQCLAAMLDTVVFK Show more

Gene and Protein Information

Species	Gene ID	Gene Symbol	Gene Name	Uniprot
HUMAN	10213	PSMD14	26S proteasome non-ATPase regulatory subunit 14	O00487
MOUSE	59029	Psmd14	26S proteasome non-ATPase regulatory subunit 14	O35593
MOUSE		Psmd14	Uncharacterized protein	Q3UWJ0
MOUSE		Psmd14	Uncharacterized protein	Q3UD26
MOUSE		Psmd14	Uncharacterized protein	Q9CSU2
RAT	311078	Psmd14	Proteasome (Prosome, macropain) 26S subunit, non-ATPase, 14	Q4V8E2

Protein Classes

PANTHER Classes
protein / transcription factor / 26S proteasome non-ATPase regulatory subunit 14
protein / metalloprotease / 26S proteasome non-ATPase regulatory subunit 14

DTO Classes
protein / Enzyme / Protease / Metalloprotease / 26S proteasome non-ATPase regulatory subunit 14

Associated Recombinant Proteins

Name	Specification and purity	Expression system	Protein label	Activity	View Details

Associated Antibodies

Name	Specifications	Species reactivity	species	Application	View Details

Associated Approved Drugs

Associated Active Ligands

Associated Diseases

Name	Disease Type	Mondoid

Pathway

Data Source	Name	Explore more targets	Explore in Source

Source: DataSourcesLicenses.xlsx