PSMD14
| Description | 26S proteasome non-ATPase regulatory subunit 14 |
|---|
Gene and Protein Information
| Gene ID | 10213 |
|---|---|
| Uniprot Accession IDs | B3KNW2 O00176 |
| Ensembl ID | ENSP00000386541 |
| Symbol | POH1 PAD1 POH1 RPN11 |
| Family | Belongs to the peptidase M67A family. PSMD14 subfamily. |
| Sequence | MDRLLRLGGGMPGLGQGPPTDAPAVDTAEQVYISSLALLKMLKHGRAGVPMEVMGLMLGEFVDDYTVRVIDVFAMPQSGTGVSVEAVDPVFQAKMLDMLKQTGRPEMVVGWYHSHPGFGCWLSGVDINTQQSFEALSERAVAVVVDPIQSVKGKVVIDAFRLINANMMVLGHEPRQTTSNLGHLNKPSIQALIHGLNRHYYSITINYRKNELEQKMLLNLHKKSWMEGLTLQDYSEHCKHNESVVKEMLELAKNYNKAVEEEDKMTPEQLAIKNVGKQDPKRHLEEHVDVLMTSNIVQCLAAMLDTVVFK Show more |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 459686 | PSMD14 | proteasome 26S subunit, non-ATPase 14 | 9598 | VGNC:2791 | OMA, EggNOG |
| Macaque | 701063 | PSMD14 | proteasome 26S subunit, non-ATPase 14 | 9544 | Inparanoid, OMA, EggNOG | |
| Mouse | 59029 | Psmd14 | proteasome (prosome, macropain) 26S subunit, non-ATPase, 14 | 10090 | MGI:1913284 | Inparanoid, OMA, EggNOG |
| Rat | 311078 | Psmd14 | proteasome 26S subunit, non-ATPase 14 | 10116 | RGD:1594532 | Inparanoid, OMA |
| Dog | 478765 | PSMD14 | proteasome 26S subunit, non-ATPase 14 | 9615 | VGNC:45110 | Inparanoid, OMA, EggNOG |
| Horse | 100051409 | PSMD14 | proteasome 26S subunit, non-ATPase 14 | 9796 | VGNC:21960 | Inparanoid, OMA, EggNOG |
| Cow | 535683 | PSMD14 | proteasome 26S subunit, non-ATPase 14 | 9913 | VGNC:33465 | Inparanoid, OMA, EggNOG |
| Pig | 100156327 | PSMD14 | proteasome 26S subunit, non-ATPase 14 | 9823 | Inparanoid, OMA, EggNOG | |
| Opossum | 100015662 | PSMD14 | proteasome 26S subunit, non-ATPase 14 | 13616 | Inparanoid, OMA, EggNOG | |
| Platypus | 100077210 | PSMD14 | proteasome 26S subunit, non-ATPase 14 | 9258 | Inparanoid, OMA, EggNOG | |
| Chicken | 424189 | PSMD14 | proteasome 26S subunit, non-ATPase 14 | 9031 | CGNC:8450 | Inparanoid, OMA, EggNOG |
| Anole lizard | 100553139 | psmd14 | proteasome 26S subunit, non-ATPase 14 | 28377 | Inparanoid, OMA, EggNOG | |
| Xenopus | 595024 | psmd14 | proteasome 26S subunit, non-ATPase 14 | 8364 | XB-GENE-950703 | Inparanoid, OMA, EggNOG |
| Zebrafish | 799058 | psmd14 | proteasome 26S subunit, non-ATPase 14 | 7955 | ZDB-GENE-070410-56 | Inparanoid, OMA, EggNOG |
| C. elegans | 173744 | rpn-11 | 26S proteasome non-ATPase regulatory subunit 14 | 6239 | Inparanoid, OMA | |
| Fruitfly | 33738 | Rpn11 | Regulatory particle non-ATPase 11 | 7227 | FBgn0028694 | Inparanoid, OMA, EggNOG |
| S.cerevisiae | 850554 | RPN11 | proteasome regulatory particle lid subunit RPN11 | 4932 | S000001900 | Inparanoid, OMA, EggNOG |
Protein Classes
PANTHER Classes
protein / transcription factor / 26S proteasome non-ATPase regulatory subunit 14
protein / metalloprotease / 26S proteasome non-ATPase regulatory subunit 14
protein / transcription factor / 26S proteasome non-ATPase regulatory subunit 14
protein / metalloprotease / 26S proteasome non-ATPase regulatory subunit 14
DTO Classes
protein / Enzyme / Protease / Metalloprotease / 26S proteasome non-ATPase regulatory subunit 14
protein / Enzyme / Protease / Metalloprotease / 26S proteasome non-ATPase regulatory subunit 14
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Disease Type | Mondoid |
|---|
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|